Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2753
Gene name
LocationContig_245:12176..12734
Strand+
Gene length (bp)558
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 1.6E-07 39 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 13 152 5.0E-36
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 16 159 6.0E-26
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 16 159 3.0E-25
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 40 153 5.0E-18
sp|Q6C531|YAE1_YARLI Uncharacterized protein YAE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAE1 PE=3 SV=1 25 144 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RK96|YAE1_MAGO7 Uncharacterized protein YAE1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YAE1 PE=3 SV=1 13 152 5.0E-36
sp|A7EB95|YAE1_SCLS1 Uncharacterized protein yae1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=yae1 PE=3 SV=1 16 159 6.0E-26
sp|A6RL85|YAE1_BOTFB Uncharacterized protein yae1 OS=Botryotinia fuckeliana (strain B05.10) GN=yae1 PE=3 SV=1 16 159 3.0E-25
sp|Q0V5P6|YAE1_PHANO Uncharacterized protein YAE1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YAE1 PE=3 SV=1 40 153 5.0E-18
sp|Q6C531|YAE1_YARLI Uncharacterized protein YAE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YAE1 PE=3 SV=1 25 144 2.0E-16
sp|Q6FUV0|YAE1_CANGA Uncharacterized protein YAE1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YAE1 PE=3 SV=1 27 152 7.0E-16
sp|A6ZQ26|YAE1_YEAS7 Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YAE1 PE=3 SV=1 11 152 1.0E-15
sp|A2QF59|YAE1_ASPNC Uncharacterized protein yae1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=yae1 PE=3 SV=1 12 81 6.0E-15
sp|P47118|YAE1_YEAST Uncharacterized protein YAE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAE1 PE=1 SV=1 11 152 7.0E-15
sp|Q4WWW5|YAE1_ASPFU Uncharacterized protein yae1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yae1 PE=3 SV=1 13 81 4.0E-14
sp|A1D7X8|YAE1_NEOFI Uncharacterized protein yae1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=yae1 PE=3 SV=1 10 81 4.0E-14
sp|Q1DQS5|YAE1_COCIM Uncharacterized protein YAE1 OS=Coccidioides immitis (strain RS) GN=YAE1 PE=3 SV=1 10 80 4.0E-14
sp|Q0CX45|YAE1_ASPTN Uncharacterized protein yae1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=yae1 PE=3 SV=1 13 81 5.0E-14
sp|A1CJJ9|YAE1_ASPCL Uncharacterized protein yae1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=yae1 PE=3 SV=1 21 86 5.0E-14
sp|Q9P840|YAE1_CANAL Uncharacterized protein YAE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YAE1 PE=3 SV=1 35 139 3.0E-12
sp|Q6BL68|YAE1_DEBHA Uncharacterized protein YAE1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YAE1 PE=3 SV=2 25 143 3.0E-12
sp|Q6CV86|YAE1_KLULA Uncharacterized protein YAE1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YAE1 PE=3 SV=1 27 112 1.0E-10
sp|A7TE16|YAE1_VANPO Uncharacterized protein YAE1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YAE1 PE=3 SV=1 14 144 2.0E-10
sp|A3LWJ7|YAE1_PICST Uncharacterized protein YAE1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=YAE1 PE=3 SV=2 15 147 4.0E-10
sp|A5DLN4|YAE1_PICGU Uncharacterized protein YAE1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=YAE1 PE=3 SV=2 25 144 1.0E-09
sp|O14045|TPT1_SCHPO Putative tRNA 2'-phosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.12c PE=3 SV=2 16 78 1.0E-06
sp|Q753A3|YAE1_ASHGO Uncharacterized protein YAE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YAE1 PE=3 SV=2 27 80 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|716
Ophiocordyceps australis map64 (Brazil) OphauB2|7409
Ophiocordyceps camponoti-floridani Ophcf2|06206
Ophiocordyceps camponoti-rufipedis Ophun1|2753 (this protein)
Ophiocordyceps kimflemingae Ophio5|7779
Ophiocordyceps subramaniannii Hirsu2|6521

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2753
MAQETGSKTEAASLDDVFCAEASHPSDVRRLQAEHAKAGYREAISTAKQTTIQAGFDDGFRLGAALGLRAGRVLG
LLEGICEAVPGEVEAEKLLATAREELSVSSLLSSSYWAPDGEGKFQTGSDDDNLADGHPLINKWNSFVDRQLARW
AIDEAVLGGEPARPLADEAIISSSAPLGARRPLDW*
Coding >Ophun1|2753
ATGGCGCAAGAAACCGGCTCCAAAACAGAGGCTGCCTCCCTCGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGGCCGAACACGCAAAGGCCGGCTATCGTGAGGCCATCTCGACGGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTCGGGTCCTCGGT
CTGCTCGAAGGCATCTGTGAAGCCGTCCCAGGCGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGTCTCCTATCCTCATCTTACTGGGCGCCAGACGGTGAGGGCAAGTTCCAAACGGGCTCTGAC
GACGACAATTTGGCCGATGGCCACCCTTTAATCAATAAGTGGAATAGCTTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGCCCGACCACTAGCTGACGAAGCCATCATCTCCTCGTCAGCC
CCTTTGGGAGCGAGGCGACCCCTAGACTGGTGA
Transcript >Ophun1|2753
ATGGCGCAAGAAACCGGCTCCAAAACAGAGGCTGCCTCCCTCGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGGCCGAACACGCAAAGGCCGGCTATCGTGAGGCCATCTCGACGGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTCGGGTCCTCGGT
CTGCTCGAAGGCATCTGTGAAGCCGTCCCAGGCGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGTCTCCTATCCTCATCTTACTGGGCGCCAGACGGTGAGGGCAAGTTCCAAACGGGCTCTGAC
GACGACAATTTGGCCGATGGCCACCCTTTAATCAATAAGTGGAATAGCTTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGCCCGACCACTAGCTGACGAAGCCATCATCTCCTCGTCAGCC
CCTTTGGGAGCGAGGCGACCCCTAGACTGGTGA
Gene >Ophun1|2753
ATGGCGCAAGAAACCGGCTCCAAAACAGAGGCTGCCTCCCTCGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGGCCGAACACGCAAAGGCCGGCTATCGTGAGGCCATCTCGACGGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTCGGGTCCTCGGT
CTGCTCGAAGGCATCTGTGAAGCCGTCCCAGGCGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGTCTCCTATCCTCATCTTACTGGGCGCCAGACGGTGAGGGCAAGTTCCAAACGGGCTCTGAC
GACGACAATTTGGCCGATGGCCACCCTTTAATCAATAAGTGGAATAGCTTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGCCCGACCACTAGCTGACGAAGCCATCATCTCCTCGTCAGCC
CCTTTGGGAGCGAGGCGACCCCTAGACTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail