Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2750
Gene name
LocationContig_245:4347..5833
Strand-
Gene length (bp)1486
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-35 83 396
PF00083 Sugar_tr Sugar (and other) transporter 1.9E-09 81 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 61 414 3.0E-58
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 61 416 5.0E-53
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 61 413 1.0E-49
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 7 413 1.0E-14
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 84 403 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 61 414 3.0E-58
sp|Q0P5M9|MFS10_BOVIN Major facilitator superfamily domain-containing protein 10 OS=Bos taurus GN=MFSD10 PE=2 SV=1 61 416 5.0E-53
sp|Q14728|MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens GN=MFSD10 PE=1 SV=1 61 413 1.0E-49
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 7 413 1.0E-14
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 84 403 3.0E-14
sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 84 403 4.0E-14
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 7 433 2.0E-12
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 71 403 3.0E-11
sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2 82 261 1.0E-09
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 74 410 1.0E-08
sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=2 SV=3 75 404 1.0E-08
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 4 403 2.0E-08
sp|P51564|TCR8_PASMD Tetracycline resistance protein, class H OS=Pasteurella multocida GN=tetA PE=3 SV=1 84 403 7.0E-08
sp|P70187|HIAT1_MOUSE Hippocampus abundant transcript 1 protein OS=Mus musculus GN=Hiat1 PE=2 SV=3 81 404 1.0E-07
sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2 81 404 1.0E-07
sp|Q8CIA9|HIAL1_MOUSE Hippocampus abundant transcript-like protein 1 OS=Mus musculus GN=Hiatl1 PE=2 SV=3 81 404 1.0E-07
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 75 410 6.0E-07
sp|A4IF94|HIAL1_BOVIN Hippocampus abundant transcript-like protein 1 OS=Bos taurus GN=HIATL1 PE=2 SV=1 81 404 1.0E-06
sp|Q6AY78|S22AI_RAT Solute carrier family 22 member 18 OS=Rattus norvegicus GN=Slc22a18 PE=2 SV=2 84 396 2.0E-06
sp|P39843|BMR2_BACSU Multidrug resistance protein 2 OS=Bacillus subtilis (strain 168) GN=blt PE=3 SV=1 81 396 3.0E-06
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 78 222 5.0E-06
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 78 222 5.0E-06
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 78 222 5.0E-06
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 78 222 5.0E-06
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 78 222 5.0E-06
sp|Q78KK3|S22AI_MOUSE Solute carrier family 22 member 18 OS=Mus musculus GN=Slc22a18 PE=1 SV=2 84 396 6.0E-06
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 78 222 6.0E-06
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 78 222 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 79 101 22
3 113 132 19
4 170 192 22
5 199 221 22
6 260 282 22
7 295 314 19
8 320 338 18
9 345 367 22
10 382 404 22
11 411 430 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2750
MAVVDRKKVLRVIIVSLLLDLISFTFILPLFPKLLEFYRDREAPALVQHGPQTLLQRVIAGLNSYKMAFSRPIDS
RHDIVLLGGAMGSLFSLLQAIASPVIGRLSDRYGRRAALLASMCGNIISVLLWLAAVDFRTFIASRVVGGLSEGN
IQLATAIASDISDDASRGSTMAIIGSCFCVAFTFGPALGAWLSTMAVMAANPFAMAAGFSLLLILVETVYLYFCL
PETLPALTQPGGRGREAVSEAKRRTTPVERTNSPWLLYAVNFFFLLFFSGMESSLSFMTYELFAFSSGKNGRLLG
FIGLVASVLQGGVTRRMPPLTSIRVGVVACLASFVLLGRINTVGGLYAAATCLATTSATVVTGLNALSSFDASED
ERGSKLGILRSWGQLGRGLGPVFFTSIYWWAGRESAYNVGATGIVMVAAAAFMGLKMPKTAGVGIKRT*
Coding >Ophun1|2750
ATGGCTGTCGTCGACAGGAAAAAGGTCCTCCGGGTCATCATCGTCTCCCTGCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCGAAGCTCCTCGAGTTCTACCGCGATCGAGAGGCTCCGGCCCTCGTCCAACATGGC
CCCCAGACGTTGCTTCAGCGCGTCATCGCCGGCCTCAACAGCTACAAGATGGCCTTTTCCCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGTTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGCGGCAACATCATATCCGTC
CTGCTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTGTCCGAGGGCAAT
ATCCAGCTTGCGACGGCCATCGCCAGCGACATTTCGGATGATGCTTCGCGCGGATCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCCTTTGCCATGGCTGCCGGCTTCAGCTTGCTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGGGGCGGGGCCGCGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGCCGGTGGAAAGGACCAACTCGCCTTGGTTACTCTACGCCGTCAACTTTTTCTTCCTGCTGTTCTTTTCTGGA
ATGGAGAGTTCGCTGTCGTTTATGACGTATGAGCTCTTCGCCTTTTCGTCGGGCAAAAACGGTAGATTGCTGGGT
TTTATTGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTGACCCGCAGGATGCCGCCTCTTACGTCCATCCGTGTC
GGCGTCGTGGCCTGTCTCGCGTCCTTTGTCCTACTCGGGAGGATCAACACGGTGGGCGGCCTTTACGCGGCTGCC
ACCTGTCTCGCCACGACTTCGGCTACCGTCGTCACCGGTCTCAATGCGCTGAGTAGTTTCGATGCTAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGGCAGCTCGGCCGCGGTCTCGGTCCCGTCTTCTTCACT
AGCATCTACTGGTGGGCGGGACGCGAGTCTGCGTACAACGTGGGCGCGACGGGCATCGTCATGGTGGCGGCGGCT
GCTTTCATGGGACTCAAGATGCCCAAGACGGCGGGCGTGGGCATCAAGCGAACGTGA
Transcript >Ophun1|2750
ATGGCTGTCGTCGACAGGAAAAAGGTCCTCCGGGTCATCATCGTCTCCCTGCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCGAAGCTCCTCGAGTTCTACCGCGATCGAGAGGCTCCGGCCCTCGTCCAACATGGC
CCCCAGACGTTGCTTCAGCGCGTCATCGCCGGCCTCAACAGCTACAAGATGGCCTTTTCCCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGTTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGCGGCAACATCATATCCGTC
CTGCTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTGTCCGAGGGCAAT
ATCCAGCTTGCGACGGCCATCGCCAGCGACATTTCGGATGATGCTTCGCGCGGATCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCCTTTGCCATGGCTGCCGGCTTCAGCTTGCTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGGGGCGGGGCCGCGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGCCGGTGGAAAGGACCAACTCGCCTTGGTTACTCTACGCCGTCAACTTTTTCTTCCTGCTGTTCTTTTCTGGA
ATGGAGAGTTCGCTGTCGTTTATGACGTATGAGCTCTTCGCCTTTTCGTCGGGCAAAAACGGTAGATTGCTGGGT
TTTATTGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTGACCCGCAGGATGCCGCCTCTTACGTCCATCCGTGTC
GGCGTCGTGGCCTGTCTCGCGTCCTTTGTCCTACTCGGGAGGATCAACACGGTGGGCGGCCTTTACGCGGCTGCC
ACCTGTCTCGCCACGACTTCGGCTACCGTCGTCACCGGTCTCAATGCGCTGAGTAGTTTCGATGCTAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGGCAGCTCGGCCGCGGTCTCGGTCCCGTCTTCTTCACT
AGCATCTACTGGTGGGCGGGACGCGAGTCTGCGTACAACGTGGGCGCGACGGGCATCGTCATGGTGGCGGCGGCT
GCTTTCATGGGACTCAAGATGCCCAAGACGGCGGGCGTGGGCATCAAGCGAACGTGA
Gene >Ophun1|2750
ATGGCTGTCGTCGACAGGAAAAAGGTCCTCCGGGTCATCATCGTCTCCCTGCTCCTTGATTTGGTCGGTGGCGCC
CCGGGCGGATCCCTACCTCGCCAAGCATCCAGACTCCGCTGACTCTCCACCCCCAAAAACACGGGCAGATCTCCT
TTACCTTCATCCTACCGCTCTTCCCGAAGCTCCTCGAGTTCTACCGCGATCGAGAGGCTCCGGCCCTCGTCCAAC
ATGGCCCCCAGACGTTGCTTCAGCGCGTCATCGCCGGCCTCAACAGCTACAAGATGGCCTTTTCCCGGCCCATCG
ATTCGCGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGTTCGCTCTTCTCGTGCGCCACTCTCATCATTCCAT
TCCCTCCTCCTGCCGTCGTCTCGTTGACAATGGCCACCCCTCTCCCCACAGCCTGCTGCAAGCCATAGCCTCGCC
CGTCATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGCGGCAACATCATATC
CGTCCTGCTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTGTCCGAGGG
CAATATCCAGCTTGCGACGGCCATCGCCAGCGACATTTCGGATGATGCTTCGCGCGGATCCACAATGGCCATCAT
CGGCTCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGC
TGCGAACCCCTTTGCCATGGCTGCCGGCTTCAGCTTGCTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTG
CCTTCCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGGGGCGGGGCCGCGAGGCCGTGTCTGAGGCGAAACGCCG
GACGACGCCGGTGGAAAGGACCAACTCGCCTTGGTTACTCTACGCCGTCAACTTTTTCTTCCTGCTGTTCTTTTC
TGGAATGGAGAGTTCGCTGTCGTTTATGACGTATGAGCTCTTCGCCTTTTCGTCGGGCAAAAACGGTAGATTGCT
GGGTTTTATTGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTGACCCGCAGGATGCCGCCTCTTACGTCCATCCG
TGTCGGCGTCGTGGCCTGTCTCGCGTCCTTTGTCCTACTCGGGAGGATCAACACGGTGGGCGGCCTTTACGCGGC
TGCCACCTGTCTCGCCACGACTTCGGCTACCGTCGTCACCGGTCTCAATGCGCTGAGTAGTTTCGATGCTAGCGA
GGACGAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGGCAGCTCGGCCGCGGTCTCGGTCCCGTCTTCTT
CACTAGCATCTACTGGTGGGCGGGACGCGAGTCTGCGTACAACGTGGGCGCGACGGGCATCGTCATGGTGGCGGC
GGCTGCTTTCATGGGACTCAAGATGCCCAAGACGGCGGGCGTGGGCATCAAGCGAACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail