Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2740
Gene name
LocationContig_243:23143..24146
Strand-
Gene length (bp)1003
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01814 Hemerythrin Hemerythrin HHE cation binding domain 9.2E-07 52 179

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.99344

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6298
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02710
Ophiocordyceps camponoti-rufipedis Ophun1|2740 (this protein)
Ophiocordyceps kimflemingae Ophio5|1833
Ophiocordyceps subramaniannii Hirsu2|8869

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2740
MAWLSIITVLALGSGALLRNSPLLYQTMPPETDQPWADQPMRLDDLFTTAATHMALLHNSLIRGYNSIHLQAPHV
RDADKPDFLAYTRTWLRFIRSHHDDEDEILFPELRSALGDDSVWGDVPQEHETLVRGLDDLGRYLDSLSNASALT
STALLAVLDHLHQPLEHHLHHEVAVMAAMATHPNVPSPDSLEGSVAAAMLKAWGKNTVRKAGLADVVPLFLLNAD
RTAEKGMWHNWPPMPRPVRWAMVNVVGAIHGSRWRFASCDGNGRPRRLYALAAAESSQKDGEL*
Coding >Ophun1|2740
ATGGCCTGGCTCTCCATCATCACCGTCCTCGCCCTCGGCAGCGGCGCTCTTCTTCGCAACTCGCCGCTGCTCTAC
CAGACAATGCCGCCCGAGACAGACCAGCCGTGGGCCGACCAGCCCATGAGACTCGATGACCTCTTCACCACGGCG
GCCACACACATGGCGCTGCTGCACAATTCGCTCATCCGCGGATACAACTCGATCCATCTCCAGGCACCGCACGTG
CGAGACGCTGACAAGCCCGACTTCCTGGCCTACACCCGCACCTGGCTGCGCTTCATCCGCTCTCACCACGACGAC
GAGGACGAGATCCTCTTCCCCGAGCTGAGATCTGCGCTTGGCGATGACTCCGTCTGGGGGGACGTGCCGCAGGAG
CACGAAACACTGGTCCGCGGGCTCGATGACCTCGGTCGCTACCTAGACTCGCTGTCGAATGCCTCGGCTTTGACG
TCTACGGCTCTCCTCGCCGTCCTCGACCACCTGCACCAGCCACTCGAGCACCACCTCCACCATGAGGTCGCCGTC
ATGGCTGCCATGGCGACTCATCCCAACGTACCGTCGCCCGACTCGCTCGAGGGCTCCGTGGCGGCGGCGATGCTC
AAGGCCTGGGGCAAGAACACGGTACGCAAGGCGGGCCTCGCCGACGTCGTTCCCCTGTTTCTCCTCAACGCGGAC
CGCACGGCTGAAAAGGGCATGTGGCACAACTGGCCGCCCATGCCGCGACCCGTGCGCTGGGCCATGGTCAACGTG
GTAGGAGCCATTCACGGCAGTCGTTGGCGATTCGCGAGCTGCGACGGCAATGGTCGACCGAGGCGGTTATATGCG
CTGGCAGCGGCGGAATCGTCGCAGAAGGACGGAGAGCTGTAG
Transcript >Ophun1|2740
ATGGCCTGGCTCTCCATCATCACCGTCCTCGCCCTCGGCAGCGGCGCTCTTCTTCGCAACTCGCCGCTGCTCTAC
CAGACAATGCCGCCCGAGACAGACCAGCCGTGGGCCGACCAGCCCATGAGACTCGATGACCTCTTCACCACGGCG
GCCACACACATGGCGCTGCTGCACAATTCGCTCATCCGCGGATACAACTCGATCCATCTCCAGGCACCGCACGTG
CGAGACGCTGACAAGCCCGACTTCCTGGCCTACACCCGCACCTGGCTGCGCTTCATCCGCTCTCACCACGACGAC
GAGGACGAGATCCTCTTCCCCGAGCTGAGATCTGCGCTTGGCGATGACTCCGTCTGGGGGGACGTGCCGCAGGAG
CACGAAACACTGGTCCGCGGGCTCGATGACCTCGGTCGCTACCTAGACTCGCTGTCGAATGCCTCGGCTTTGACG
TCTACGGCTCTCCTCGCCGTCCTCGACCACCTGCACCAGCCACTCGAGCACCACCTCCACCATGAGGTCGCCGTC
ATGGCTGCCATGGCGACTCATCCCAACGTACCGTCGCCCGACTCGCTCGAGGGCTCCGTGGCGGCGGCGATGCTC
AAGGCCTGGGGCAAGAACACGGTACGCAAGGCGGGCCTCGCCGACGTCGTTCCCCTGTTTCTCCTCAACGCGGAC
CGCACGGCTGAAAAGGGCATGTGGCACAACTGGCCGCCCATGCCGCGACCCGTGCGCTGGGCCATGGTCAACGTG
GTAGGAGCCATTCACGGCAGTCGTTGGCGATTCGCGAGCTGCGACGGCAATGGTCGACCGAGGCGGTTATATGCG
CTGGCAGCGGCGGAATCGTCGCAGAAGGACGGAGAGCTGTAG
Gene >Ophun1|2740
ATGGCCTGGCTCTCCATCATCACCGTCCTCGCCCTCGGCAGCGGCGCTCTTCTTCGCAACTCGCCGCTGCTCTAC
CAGACAATGCCGCCCGAGACAGACCAGCCGTGGGCCGACCAGCCCATGAGACTCGTTTCGACGCCCCAGTTTCAG
TCGGCCAAGGCAAGTTCTTCGACGAGGTTTGATCGGTTCGGTGCTGATGGCTGAATAGGATGACCTCTTCACCAC
GGCGGCCACACACATGGCGCTGCTGCACAATTCGCTCATCCGCGGATACAACTCGATCCATCTCCAGGCACCGCA
CGTGCGAGACGCTGACAAGCCCGACTTCCTGGCCTACACCCGCACCTGGCTGCGCTTCATCCGCTCTCACCACGA
CGACGAGGACGAGATCCTCTTCCCCGAGCTGAGATCTGCGCTTGGCGATGACTCCGTCTGGGGGGACGTGCCGCA
GGAGCACGGTACGCTCTATGAATCCGTCTCGGCAGCCAGCTTGCTGACGGAACCTGGACGTTGAGAAACACTGGT
CCGCGGGCTCGATGACCTCGGTCGCTACCTAGACTCGCTGTCGAATGCCTCGGCTTTGACGTCTACGGCTCTCCT
CGCCGTCCTCGACCACCTGCACCAGCCACTCGAGCACCACCTCCACCATGAGGTCGCCGTCATGGCTGCCATGGC
GACTCATCCCAACGTACCGTCGCCCGACTCGCTCGAGGGCTCCGTGGCGGCGGCGATGCTCAAGGCCTGGGGCAA
GAACACGGTACGCAAGGCGGGCCTCGCCGACGTCGTTCCCCTGTTTCTCCTCAACGCGGACCGCACGGCTGAAAA
GGGCATGTGGCACAACTGGCCGCCCATGCCGCGACCCGTGCGCTGGGCCATGGTCAACGTGGTAGGAGCCATTCA
CGGCAGTCGTTGGCGATTCGCGAGCTGCGACGGCAATGGTCGACCGAGGCGGTTATATGCGCTGGCAGCGGCGGA
ATCGTCGCAGAAGGACGGAGAGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail