Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2739
Gene name
LocationContig_243:22414..23140
Strand+
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.5E-05 115 188

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 68 90 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2739
MDHPPPDPPELSFALALDSDRREALRLVADSIAQQRQVASLAVIFHPLCLAGLVAGCAVSLRHSGPDLGSSLLSV
SCLVMAYLAAVRAYTGPFLRLAESFDSAAFVAGPDGVQDVILVARFGDQLIGTIVLRLPPSAADDQVPPQGLIRA
WTTTLRYRGKGIGADLLRYAVSFTRAVCGDSATLSFDPDHANAACPLNGLFRRPFAVRDAKAAKALEHALRDCDA
NRGGFQKAALQTQNAT*
Coding >Ophun1|2739
ATGGATCACCCGCCTCCAGACCCCCCGGAGCTCTCCTTCGCCCTCGCCCTCGACTCCGACCGTCGCGAGGCTCTG
CGCCTTGTCGCCGACAGCATCGCCCAGCAGCGCCAGGTCGCCTCACTGGCCGTCATCTTTCATCCGCTCTGCTTG
GCTGGCCTCGTCGCCGGCTGTGCCGTCTCGTTGCGCCACAGCGGCCCTGATCTCGGCTCTTCTCTTCTATCCGTC
TCTTGTCTCGTCATGGCCTATCTGGCTGCCGTCCGTGCTTATACCGGGCCCTTTCTGCGTCTCGCCGAGAGCTTC
GACTCCGCTGCCTTTGTCGCCGGACCAGACGGTGTCCAAGATGTCATTCTCGTTGCCCGCTTCGGCGACCAGCTT
ATCGGCACCATTGTTCTGCGGCTTCCTCCGTCGGCTGCTGATGACCAAGTTCCTCCACAAGGGCTCATCCGCGCC
TGGACGACGACGCTGAGGTATCGTGGCAAAGGCATCGGCGCCGATCTTTTACGCTACGCCGTCTCCTTTACCCGT
GCCGTATGCGGTGATTCTGCTACTCTGAGCTTCGATCCGGATCATGCCAATGCCGCCTGCCCCCTGAACGGGCTC
TTCCGTCGTCCTTTCGCCGTACGCGACGCCAAGGCGGCCAAGGCGCTGGAACACGCATTACGAGACTGCGATGCC
AACCGCGGTGGCTTCCAAAAGGCCGCATTGCAGACACAGAATGCTACTTGA
Transcript >Ophun1|2739
ATGGATCACCCGCCTCCAGACCCCCCGGAGCTCTCCTTCGCCCTCGCCCTCGACTCCGACCGTCGCGAGGCTCTG
CGCCTTGTCGCCGACAGCATCGCCCAGCAGCGCCAGGTCGCCTCACTGGCCGTCATCTTTCATCCGCTCTGCTTG
GCTGGCCTCGTCGCCGGCTGTGCCGTCTCGTTGCGCCACAGCGGCCCTGATCTCGGCTCTTCTCTTCTATCCGTC
TCTTGTCTCGTCATGGCCTATCTGGCTGCCGTCCGTGCTTATACCGGGCCCTTTCTGCGTCTCGCCGAGAGCTTC
GACTCCGCTGCCTTTGTCGCCGGACCAGACGGTGTCCAAGATGTCATTCTCGTTGCCCGCTTCGGCGACCAGCTT
ATCGGCACCATTGTTCTGCGGCTTCCTCCGTCGGCTGCTGATGACCAAGTTCCTCCACAAGGGCTCATCCGCGCC
TGGACGACGACGCTGAGGTATCGTGGCAAAGGCATCGGCGCCGATCTTTTACGCTACGCCGTCTCCTTTACCCGT
GCCGTATGCGGTGATTCTGCTACTCTGAGCTTCGATCCGGATCATGCCAATGCCGCCTGCCCCCTGAACGGGCTC
TTCCGTCGTCCTTTCGCCGTACGCGACGCCAAGGCGGCCAAGGCGCTGGAACACGCATTACGAGACTGCGATGCC
AACCGCGGTGGCTTCCAAAAGGCCGCATTGCAGACACAGAATGCTACTTGA
Gene >Ophun1|2739
ATGGATCACCCGCCTCCAGACCCCCCGGAGCTCTCCTTCGCCCTCGCCCTCGACTCCGACCGTCGCGAGGCTCTG
CGCCTTGTCGCCGACAGCATCGCCCAGCAGCGCCAGGTCGCCTCACTGGCCGTCATCTTTCATCCGCTCTGCTTG
GCTGGCCTCGTCGCCGGCTGTGCCGTCTCGTTGCGCCACAGCGGCCCTGATCTCGGCTCTTCTCTTCTATCCGTC
TCTTGTCTCGTCATGGCCTATCTGGCTGCCGTCCGTGCTTATACCGGGCCCTTTCTGCGTCTCGCCGAGAGCTTC
GACTCCGCTGCCTTTGTCGCCGGACCAGACGGTGTCCAAGATGTCATTCTCGTTGCCCGCTTCGGCGACCAGCTT
ATCGGCACCATTGTTCTGCGGCTTCCTCCGTCGGCTGCTGATGACCAAGTTCCTCCACAAGGGCTCATCCGCGCC
TGGACGACGACGCTGAGGTATCGTGGCAAAGGCATCGGCGCCGATCTTTTACGCTACGCCGTCTCCTTTACCCGT
GCCGTATGCGGTGATTCTGCTACTCTGAGCTTCGATCCGGATCATGCCAATGCCGCCTGCCCCCTGAACGGGCTC
TTCCGTCGTCCTTTCGCCGTACGCGACGCCAAGGCGGCCAAGGCGCTGGAACACGCATTACGAGACTGCGATGCC
AACCGCGGTGGCTTCCAAAAGGCCGCATTGCAGACACAGAATGCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail