Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2738
Gene name
LocationContig_243:19603..21541
Strand-
Gene length (bp)1938
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-44 82 558
PF07690 MFS_1 Major Facilitator Superfamily 9.6E-16 126 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 16 558 0.0E+00
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 34 560 0.0E+00
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 64 561 6.0E-111
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 64 579 4.0E-110
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 64 579 8.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 16 558 0.0E+00
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 34 560 0.0E+00
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 64 561 6.0E-111
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 64 579 4.0E-110
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 64 579 8.0E-110
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 57 560 1.0E-108
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 64 561 9.0E-107
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 59 579 1.0E-106
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 64 561 3.0E-106
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 58 567 8.0E-106
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 56 560 3.0E-105
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 64 560 1.0E-102
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 56 574 4.0E-102
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 57 560 6.0E-102
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 64 568 1.0E-101
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 59 559 3.0E-101
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 64 561 1.0E-97
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 57 560 3.0E-97
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 64 560 1.0E-96
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 64 581 4.0E-96
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 56 560 5.0E-96
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 57 559 2.0E-93
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 52 558 3.0E-91
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 78 558 3.0E-91
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 64 587 2.0E-90
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 76 571 3.0E-87
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 64 587 1.0E-86
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 31 561 1.0E-85
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 64 573 1.0E-78
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 127 508 5.0E-24
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 52 576 2.0E-20
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 78 555 4.0E-18
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 52 514 2.0E-14
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 184 587 2.0E-13
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 129 556 7.0E-12
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 130 558 9.0E-11
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 128 556 5.0E-10
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 128 558 6.0E-10
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 121 556 9.0E-10
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 128 589 2.0E-09
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 120 589 2.0E-09
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 128 558 2.0E-09
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 177 558 3.0E-09
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 3 503 4.0E-09
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 130 558 6.0E-09
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 130 504 7.0E-09
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 128 589 1.0E-08
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 67 503 2.0E-08
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 119 569 2.0E-08
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 67 503 2.0E-08
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 66 503 3.0E-08
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 81 558 4.0E-08
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 130 558 5.0E-08
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 121 568 8.0E-08
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 67 503 1.0E-07
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 78 368 1.0E-07
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 78 361 2.0E-07
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 130 558 2.0E-07
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 127 450 2.0E-07
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 78 361 2.0E-07
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 128 576 2.0E-07
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 130 589 2.0E-07
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 67 359 3.0E-07
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 121 556 3.0E-07
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 229 558 4.0E-07
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 130 589 4.0E-07
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 115 359 7.0E-07
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 163 558 8.0E-07
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 55 462 9.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 130 556 1.0E-06
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 130 493 2.0E-06
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 179 557 2.0E-06
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 67 503 2.0E-06
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 173 557 2.0E-06
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 143 443 3.0E-06
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 130 558 3.0E-06
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 130 558 3.0E-06
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 163 558 3.0E-06
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 177 558 4.0E-06
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 129 558 4.0E-06
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 130 558 5.0E-06
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 115 301 5.0E-06
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 115 301 5.0E-06
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 3 564 5.0E-06
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 115 359 6.0E-06
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 115 301 6.0E-06
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 115 301 6.0E-06
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 115 301 6.0E-06
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 115 301 7.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 121 556 7.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 67 503 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 151 170 19
3 180 202 22
4 215 237 22
5 264 286 22
6 348 370 22
7 397 416 19
8 429 446 17
9 456 478 22
10 491 513 22
11 528 547 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2738
MAMASEPSIVVVNSNNNINNNNINNPNKASNKANKTTGGNSAYHNFHNDFIHVTDLNERRRLALAEVDRAPFGWY
HVRAIAVAGVGFFTDSYDIFTASLLTIMLGIVYFPGVGHMPTSSDDAIKLATSAGTIVGQLGFGCMADIVGRRQM
YGLELFVIIVATIGQALTSGSPSCSIVGLVIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMAAVFAMQGLG
QLGAAMVMLFVTLGFRSHLEVAPDIAQCDGMCRVSVDRMWRILIGFGAVPACIALYFRLTIPETPRYTFDAARDV
EKAPAEVTAYESGTRVGEQDAVAGSESSETPKASWSDFFRHYSKLKNFKLLLGTAGSWFCLDVAFYGLSLNNGTI
LSVIGYSTKNSNNVYDFLYKTAVGNLIIVLAGAVPGYWVSVFTIDILGRKKIQMGGFIILVAILVSMGFAYNHLS
PEGLLGLYVVAQFFFNFGPNTTTFIVPGEVFPTRYRSTSHGISAAMGKLGSIIGQSAIATLRTHGATKENPSPWM
NHVLQIYALFMLLGCFTTLLIPETARKTLEELNGEDTYAIEAADTSGDTSPVKPRLTPGSSNAE*
Coding >Ophun1|2738
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGTCAACAGCAACAACAACATCAACAATAACAACATCAACAAC
CCCAACAAGGCCTCCAACAAGGCCAACAAGACGACGGGCGGCAACAGCGCCTACCACAACTTCCACAACGACTTC
ATTCACGTTACCGACCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTCACGGCCTCCCTGTTG
ACCATTATGCTCGGAATTGTCTACTTTCCGGGCGTCGGCCACATGCCCACCAGCTCCGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCATGGCAGACATTGTCGGACGCAGGCAAATG
TACGGGCTGGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCGTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATTATGGGAATTGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAATTCGCCACGACCAAGTGGAGAGGCGCCATGATGGCCGCCGTCTTTGCCATGCAGGGTCTCGGC
CAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCACCTCGAGGTGGCGCCTGACATT
GCTCAATGCGACGGCATGTGCCGCGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCC
GCCTGCATCGCCCTATACTTCCGTCTCACGATCCCCGAAACGCCCCGATACACCTTTGACGCGGCCCGTGACGTT
GAAAAGGCCCCGGCTGAAGTCACGGCCTACGAGTCCGGCACGCGCGTCGGCGAGCAAGATGCAGTGGCCGGGTCC
GAGAGCTCCGAGACGCCCAAGGCCAGCTGGTCCGACTTCTTCCGCCACTACTCCAAGCTCAAGAACTTCAAGCTG
CTCCTCGGCACCGCTGGCTCCTGGTTCTGCCTGGATGTCGCCTTCTACGGCCTGTCTCTCAACAACGGCACCATC
CTGAGCGTCATCGGCTACTCGACGAAAAACTCCAACAACGTCTACGACTTTCTCTACAAGACGGCCGTCGGCAAC
CTCATCATTGTCCTTGCCGGCGCCGTCCCGGGCTACTGGGTGTCCGTCTTTACCATTGACATCCTGGGCCGCAAG
AAGATTCAGATGGGCGGTTTCATCATCCTCGTCGCCATTCTCGTCTCGATGGGTTTCGCCTACAATCACCTCTCG
CCCGAGGGCCTCTTGGGTCTCTATGTCGTTGCCCAGTTCTTCTTCAACTTTGGTCCCAACACGACCACCTTCATC
GTCCCCGGAGAGGTCTTTCCCACCCGCTATCGGTCGACGTCGCACGGCATCTCAGCCGCCATGGGCAAGCTCGGG
TCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCAAGGAAAACCCATCGCCGTGGATG
AACCACGTGCTGCAAATCTACGCCCTCTTCATGCTCCTCGGCTGCTTCACCACGCTGCTCATCCCGGAGACGGCG
CGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCGCGGACACGTCGGGCGATACCTCG
CCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAATGA
Transcript >Ophun1|2738
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGTCAACAGCAACAACAACATCAACAATAACAACATCAACAAC
CCCAACAAGGCCTCCAACAAGGCCAACAAGACGACGGGCGGCAACAGCGCCTACCACAACTTCCACAACGACTTC
ATTCACGTTACCGACCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTCACGGCCTCCCTGTTG
ACCATTATGCTCGGAATTGTCTACTTTCCGGGCGTCGGCCACATGCCCACCAGCTCCGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCATGGCAGACATTGTCGGACGCAGGCAAATG
TACGGGCTGGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCGTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATTATGGGAATTGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAATTCGCCACGACCAAGTGGAGAGGCGCCATGATGGCCGCCGTCTTTGCCATGCAGGGTCTCGGC
CAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCACCTCGAGGTGGCGCCTGACATT
GCTCAATGCGACGGCATGTGCCGCGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCC
GCCTGCATCGCCCTATACTTCCGTCTCACGATCCCCGAAACGCCCCGATACACCTTTGACGCGGCCCGTGACGTT
GAAAAGGCCCCGGCTGAAGTCACGGCCTACGAGTCCGGCACGCGCGTCGGCGAGCAAGATGCAGTGGCCGGGTCC
GAGAGCTCCGAGACGCCCAAGGCCAGCTGGTCCGACTTCTTCCGCCACTACTCCAAGCTCAAGAACTTCAAGCTG
CTCCTCGGCACCGCTGGCTCCTGGTTCTGCCTGGATGTCGCCTTCTACGGCCTGTCTCTCAACAACGGCACCATC
CTGAGCGTCATCGGCTACTCGACGAAAAACTCCAACAACGTCTACGACTTTCTCTACAAGACGGCCGTCGGCAAC
CTCATCATTGTCCTTGCCGGCGCCGTCCCGGGCTACTGGGTGTCCGTCTTTACCATTGACATCCTGGGCCGCAAG
AAGATTCAGATGGGCGGTTTCATCATCCTCGTCGCCATTCTCGTCTCGATGGGTTTCGCCTACAATCACCTCTCG
CCCGAGGGCCTCTTGGGTCTCTATGTCGTTGCCCAGTTCTTCTTCAACTTTGGTCCCAACACGACCACCTTCATC
GTCCCCGGAGAGGTCTTTCCCACCCGCTATCGGTCGACGTCGCACGGCATCTCAGCCGCCATGGGCAAGCTCGGG
TCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCAAGGAAAACCCATCGCCGTGGATG
AACCACGTGCTGCAAATCTACGCCCTCTTCATGCTCCTCGGCTGCTTCACCACGCTGCTCATCCCGGAGACGGCG
CGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCGCGGACACGTCGGGCGATACCTCG
CCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAATGA
Gene >Ophun1|2738
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGTCAACAGCAACAACAACATCAACAATAACAACATCAACAAC
CCCAACAAGGCCTCCAACAAGGCCAACAAGACGACGGGCGGCAACAGCGCCTACCACAACTTCCACAACGACTTC
ATTCACGTTACCGACCTCAATGAGCGCCGTCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACCGACTCGTACGACATCTTCACGGCCTCCCTGTTG
ACCATTATGCTCGGAATTGTCTACTTTCCGGGCGTCGGCCACATGCCCACCAGCTCCGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCATGGCAGACATTGTCGGACGCAGGCAAATG
TACGGGCTGGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCGTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATTATGGGAATTGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAGTCGGTTCTCTCCTCAATTCTTCTCTCAGCGGCCATCTCTAACAATTGAGTCTCAGATTCGCCA
CGACCAAGTGGAGAGGCGCCATGATGGCCGCCGTCTTTGCCATGCAGGGTCTCGGCCAGCTGGGCGCCGCCATGG
TCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCACCTCGAGGTGGCGCCTGACATTGCTCAATGCGACGGCATGT
GCCGCGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCCGCCTGCATCGCCCTATACT
GTGAGCCGTTCTGCCGTCTATTTCGCTCTCGGACCACTGACATGTGAATCCCTGCAGTCCGTCTCACGATCCCCG
AAACGCCCCGATACACCTTTGACGCGGCCCGTGACGTTGAAAAGGCCCCGGCTGAAGTCACGGCCTACGAGTCCG
GCACGCGCGTCGGCGAGCAAGATGCAGTGGCCGGGTCCGAGAGCTCCGAGACGCCCAAGGCCAGCTGGTCCGACT
TCTTCCGCCACTACTCCAAGCTCAAGAACTTCAAGCTGCTCCTCGGCACCGCTGGCTCCTGGTTCTGCCTGGATG
TCGCCTTCTACGGCCTGTCTCTCAACAACGGCACCATCCTGAGCGTCATCGGCTACTCGACGAAAAACTCCAACA
ACGTCTACGACTTTCTCTACAAGACGGCCGTCGGCAACCTCATCATTGTCCTTGCCGGCGCCGTCCCGGGCTACT
GGGTGTCCGTCTTTACCATTGACATCCTGGGCCGCAAGAAGATTCAGATGGGCGGTTTCATCATCCTCGTCGCCA
TTCTCGTCTCGATGGGTTTCGCCTACAATCACCTCTCGCCCGAGGGCCTCTTGGGTCTCTATGTCGTTGCCCAGT
TCTTCTTCAACTTTGGTACGTCTTGTCTCTTTTCCTTTTCTCTTGGCAACCGCTGACCGACAACATCTAGGTCCC
AACACGACCACCTTCATCGTCCCCGGAGAGGTCTTTCCCACCCGCTATCGGTCGACGTCGCACGGCATCTCAGCC
GCCATGGGCAAGCTCGGGTCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCAAGGAA
AACCCATCGCCGTGGATGAACCACGTGCTGCAAATCTACGCCCTCTTCATGCTCCTCGGCTGCTTCACCACGCTG
CTCATCCCGGAGACGGCGCGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCGCGGAC
ACGTCGGGCGATACCTCGCCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail