Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2720
Gene name
LocationContig_241:23032..24539
Strand+
Gene length (bp)1507
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 1.5E-58 143 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 2 449 5.0E-179
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 49 419 2.0E-101
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 47 423 8.0E-94
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 89 424 1.0E-90
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 105 423 1.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 2 449 5.0E-179
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 49 419 2.0E-101
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 47 423 8.0E-94
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 89 424 1.0E-90
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 105 423 1.0E-89
sp|P06700|SIR2_YEAST NAD-dependent histone deacetylase SIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIR2 PE=1 SV=1 105 423 7.0E-88
sp|P53685|HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST1 PE=1 SV=1 105 423 6.0E-86
sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 105 424 4.0E-83
sp|Q96EB6|SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens GN=SIRT1 PE=1 SV=2 62 446 7.0E-76
sp|Q923E4|SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus GN=Sirt1 PE=1 SV=2 62 422 2.0E-75
sp|O59923|SIR2_CANAL NAD-dependent histone deacetylase SIR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIR2 PE=1 SV=2 127 423 3.0E-75
sp|Q9VK34|SIR2_DROME NAD-dependent histone deacetylase Sir2 OS=Drosophila melanogaster GN=Sir2 PE=1 SV=1 93 417 1.0E-72
sp|Q60L58|SIR2_CAEBR NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis briggsae GN=sir-2.1 PE=3 SV=1 98 429 1.0E-64
sp|Q21921|SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans GN=sir-2.1 PE=1 SV=1 98 418 1.0E-63
sp|Q54GV7|SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum GN=sir2D PE=2 SV=1 78 419 1.0E-59
sp|Q5AW69|HST21_EMENI NAD-dependent protein deacetylase hst2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7461 PE=3 SV=1 138 419 4.0E-55
sp|Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens GN=SIRT3 PE=1 SV=2 136 419 8.0E-49
sp|Q9USN7|HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst2 PE=3 SV=1 134 419 1.0E-48
sp|Q9I7I7|SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster GN=Sirt2 PE=3 SV=1 138 419 3.0E-48
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 134 419 2.0E-47
sp|P0CS88|HST22_EMENI NAD-dependent protein deacetylase hst2-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11873 PE=3 SV=1 136 419 8.0E-47
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 124 419 9.0E-47
sp|Q54P49|SIR2C_DICDI NAD-dependent deacetylase sir2C OS=Dictyostelium discoideum GN=sir2C PE=2 SV=1 133 419 2.0E-45
sp|Q5RJQ4|SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus GN=Sirt2 PE=1 SV=1 133 437 2.0E-44
sp|Q5A985|HST2_CANAL NAD-dependent protein deacetylase HST2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST2 PE=3 SV=1 124 448 3.0E-43
sp|Q7ZVK3|SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio GN=sirt2 PE=2 SV=1 131 456 8.0E-43
sp|Q8VDQ8|SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus GN=Sirt2 PE=1 SV=2 114 419 1.0E-42
sp|Q25337|SIR2_LEIMA NAD-dependent protein deacetylase SIR2rp1 OS=Leishmania major GN=SIR2rp1 PE=2 SV=2 138 398 2.0E-41
sp|Q4R834|SIR2_MACFA NAD-dependent protein deacetylase sirtuin-2 OS=Macaca fascicularis GN=SIRT2 PE=2 SV=1 133 419 6.0E-41
sp|Q57V41|SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp1 PE=1 SV=1 124 394 8.0E-41
sp|Q5RBF1|SIR2_PONAB NAD-dependent protein deacetylase sirtuin-2 OS=Pongo abelii GN=SIRT2 PE=2 SV=1 133 419 1.0E-40
sp|Q8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens GN=SIRT2 PE=1 SV=2 133 419 3.0E-40
sp|P53686|HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST2 PE=1 SV=1 135 419 2.0E-35
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 123 417 3.0E-28
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 123 373 2.0E-27
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 137 386 4.0E-24
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 128 407 1.0E-23
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 123 375 3.0E-22
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 127 432 6.0E-21
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 123 417 6.0E-20
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 129 415 2.0E-19
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 125 417 2.0E-18
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 131 375 3.0E-18
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 131 375 1.0E-17
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 130 417 1.0E-17
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 131 418 5.0E-17
sp|Q9UZE7|NPD_PYRAB NAD-dependent protein deacylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cobB PE=3 SV=1 125 375 2.0E-16
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 123 417 2.0E-16
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 125 375 2.0E-16
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 127 375 3.0E-16
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 124 375 9.0E-16
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 129 410 1.0E-15
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 124 373 1.0E-15
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 130 378 3.0E-15
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 119 375 5.0E-15
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 131 373 9.0E-15
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 127 373 9.0E-15
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 132 375 1.0E-14
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 131 373 1.0E-14
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 131 373 2.0E-14
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 97 399 2.0E-14
sp|Q9I4E1|NPD2_PSEAE NAD-dependent protein deacylase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB2 PE=3 SV=1 123 376 2.0E-14
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 130 378 3.0E-14
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 123 412 6.0E-14
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 125 375 7.0E-14
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 131 373 8.0E-14
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 125 369 8.0E-14
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 132 375 9.0E-14
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 105 399 9.0E-14
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 127 413 1.0E-13
sp|Q8NSM4|NPD_CORGL NAD-dependent protein deacylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cobB PE=3 SV=1 123 375 1.0E-13
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 127 373 1.0E-13
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 118 399 1.0E-13
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 131 375 2.0E-13
sp|Q927A7|NPD_LISIN NAD-dependent protein deacetylase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cobB PE=3 SV=1 122 378 2.0E-13
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 137 375 2.0E-13
sp|Q4JBN2|NPD_SULAC NAD-dependent protein deacetylase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cobB PE=3 SV=2 131 375 2.0E-13
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 123 412 3.0E-13
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 131 373 3.0E-13
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 131 377 4.0E-13
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 97 416 5.0E-13
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 132 413 6.0E-13
sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 125 418 7.0E-13
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 126 376 8.0E-13
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 130 367 8.0E-13
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 97 412 9.0E-13
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 127 375 9.0E-13
sp|Q5HM33|NPD_STAEQ NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cobB PE=3 SV=1 131 377 1.0E-12
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 97 416 1.0E-12
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 125 369 2.0E-12
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 123 369 2.0E-12
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 128 375 2.0E-12
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 125 369 2.0E-12
sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 125 439 2.0E-12
sp|Q8PDM9|NPD_XANCP NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cobB PE=3 SV=1 131 369 2.0E-12
sp|Q4UZX0|NPD_XANC8 NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cobB PE=3 SV=1 131 369 2.0E-12
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 124 376 3.0E-12
sp|B0RM75|NPD_XANCB NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cobB PE=3 SV=1 131 369 3.0E-12
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 123 399 3.0E-12
sp|Q8Y3U2|NPD_LISMO NAD-dependent protein deacetylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cobB PE=3 SV=1 122 378 3.0E-12
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 126 298 7.0E-12
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 128 375 8.0E-12
sp|C1DBX3|NPD_LARHH NAD-dependent protein deacetylase OS=Laribacter hongkongensis (strain HLHK9) GN=cobB PE=3 SV=1 137 257 1.0E-11
sp|Q71W25|NPD_LISMF NAD-dependent protein deacetylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cobB PE=3 SV=1 122 378 1.0E-11
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 125 379 2.0E-11
sp|Q5V4Q5|NPD_HALMA NAD-dependent protein deacetylase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cobB PE=3 SV=1 124 373 5.0E-11
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 129 417 1.0E-10
sp|Q8PQK3|NPD_XANAC NAD-dependent protein deacetylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cobB PE=3 SV=2 131 369 1.0E-10
sp|Q72IV5|NPD_THET2 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=cobB PE=3 SV=1 125 375 1.0E-10
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 125 376 1.0E-10
sp|Q8NVC8|NPD_STAAW NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MW2) GN=cobB PE=3 SV=1 123 377 2.0E-10
sp|Q6G7B7|NPD_STAAS NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MSSA476) GN=cobB PE=3 SV=1 123 377 2.0E-10
sp|Q6GEN2|NPD_STAAR NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MRSA252) GN=cobB PE=3 SV=1 130 377 4.0E-10
sp|Q8FRV5|NPD2_COREF NAD-dependent protein deacylase 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB2 PE=3 SV=2 123 375 4.0E-10
sp|P66816|NPD_STAAN NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain N315) GN=cobB PE=3 SV=1 123 377 5.0E-10
sp|P66815|NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cobB PE=1 SV=1 123 377 5.0E-10
sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 130 418 6.0E-10
sp|Q20481|SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans GN=sir-2.3 PE=3 SV=1 123 377 6.0E-10
sp|Q5SIH7|NPD_THET8 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cobB PE=3 SV=1 125 375 7.0E-10
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 132 260 7.0E-10
sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 125 375 8.0E-10
sp|Q9I4L0|NPD1_PSEAE NAD-dependent protein deacylase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB1 PE=3 SV=1 129 416 1.0E-09
sp|F7D4X9|SIR5_MONDO NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Monodelphis domestica GN=SIRT5 PE=3 SV=1 102 276 1.0E-09
sp|Q8IE47|SIR5_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) GN=Sir2A PE=1 SV=1 124 395 2.0E-09
sp|Q53700|NPD_STAA8 NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain NCTC 8325) GN=cobB PE=3 SV=1 130 377 2.0E-09
sp|Q5HE07|NPD_STAAC NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain COL) GN=cobB PE=3 SV=1 130 377 2.0E-09
sp|A0QDH4|NPD1_MYCA1 NAD-dependent protein deacetylase 1 OS=Mycobacterium avium (strain 104) GN=cobB1 PE=3 SV=1 138 369 2.0E-09
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 125 399 9.0E-09
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 132 395 1.0E-08
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 127 376 3.0E-08
sp|Q8ELR0|NPD_OCEIH NAD-dependent protein deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cobB PE=3 SV=1 132 258 4.0E-08
sp|Q8Y015|NPD_RALSO NAD-dependent protein deacylase OS=Ralstonia solanacearum (strain GMI1000) GN=cobB PE=3 SV=1 132 375 4.0E-08
sp|Q9VAQ1|SIR7_DROME NAD-dependent protein deacetylase Sirt7 OS=Drosophila melanogaster GN=Sirt7 PE=1 SV=2 125 257 2.0E-07
sp|A9A0B2|NPD_DESOH NAD-dependent protein deacylase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=cobB PE=3 SV=1 123 257 2.0E-07
sp|A8NWP2|SIR5_COPC7 NAD-dependent protein deacylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00083 PE=3 SV=2 123 420 2.0E-07
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 138 281 3.0E-07
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 125 258 3.0E-07
sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 138 257 9.0E-07
sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 138 257 9.0E-07
sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 135 257 1.0E-06
sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 135 257 1.0E-06
sp|Q7WLE5|NPD_BORBR NAD-dependent protein deacetylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cobB PE=3 SV=1 131 413 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051287 NAD binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3057
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7901
Ophiocordyceps australis map64 (Brazil) OphauB2|2549
Ophiocordyceps camponoti-floridani Ophcf2|01458
Ophiocordyceps camponoti-rufipedis Ophun1|2720 (this protein)
Ophiocordyceps kimflemingae Ophio5|1021
Ophiocordyceps subramaniannii Hirsu2|5293

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2720
MSLTELEERVKDVKESWETDSLFEDAFEELSSESLLAASGPVEGCCSPEEAGRLRRELREYGPAVFCQRTVDAGR
YTAKKLLTAFNIRPPPFLDGELDKAYFGLLALAMTRELSKRAKLSRWNSVDDAVRLLDRSSNIVVITGAGISTSL
GIPDFRSKGTGLYSKLEHLGLSDPQEVFDIEVFKQDPTIFYSVAKDIVPATDRFTPTHHFISMLHHRSKLLTNYS
QNIDNLEVKAGLPLDRLVQCHGSFGSATCIQCGHTMAGDAILPHIRAGQVPRCPRCLKASLRNNGASLKRKRASN
ADKKRRRWSDSSADDDDDDDDDDVPVAGVMKPDITFFGEPLPDEFSRRLTEHDRDKVDLVVVIGTSLKVTPVSEI
VSWLPPHIPQIYISRQPVNHINFDIDLLGDCDVVIAELCRRLGWPLAHDMAVPDEQLIDVRAEPGYTSRHVFEVR
KSAAAD*
Coding >Ophun1|2720
ATGTCGCTTACTGAGTTGGAGGAGAGGGTTAAGGATGTGAAGGAGTCGTGGGAGACGGACTCTCTGTTTGAGGAT
GCTTTTGAGGAGCTCAGCAGTGAGTCGTTGCTGGCTGCATCTGGTCCCGTCGAGGGCTGCTGCTCGCCCGAAGAA
GCCGGTCGTCTTCGGCGAGAACTGCGCGAGTACGGTCCAGCCGTCTTCTGCCAGCGGACCGTCGACGCAGGCCGA
TACACAGCCAAGAAGCTCCTAACAGCCTTCAACATCCGTCCGCCGCCCTTCCTCGACGGCGAGCTGGACAAGGCC
TACTTCGGTCTCCTCGCGCTGGCCATGACGCGCGAGTTGTCCAAGCGAGCCAAGCTTTCGCGCTGGAACTCGGTG
GACGATGCGGTCCGGCTGCTGGATCGGAGCAGTAACATCGTCGTCATTACCGGTGCTGGCATCTCTACTTCGCTT
GGCATCCCAGACTTTCGTTCCAAGGGCACCGGACTCTACTCTAAGCTGGAGCATCTTGGACTCAGTGATCCGCAG
GAGGTGTTTGACATTGAAGTCTTCAAGCAGGATCCCACCATCTTCTACTCGGTGGCAAAGGACATCGTCCCAGCA
ACAGACCGCTTCACGCCAACGCACCACTTCATCTCCATGCTCCACCACCGCAGCAAACTCCTAACCAACTACTCG
CAAAACATCGACAACCTAGAAGTCAAAGCCGGCCTCCCCCTCGACCGCCTCGTCCAATGCCACGGCTCCTTCGGC
TCAGCAACCTGCATCCAATGCGGCCACACCATGGCCGGCGACGCCATCCTCCCGCACATCAGGGCAGGACAGGTT
CCCCGCTGTCCACGATGTCTCAAGGCCTCGCTGAGGAACAACGGCGCGTCGCTCAAGAGGAAGCGCGCCTCCAAC
GCCGACAAGAAGAGGAGGAGGTGGTCGGATAGCTCGGCTGACGATGACGACGACGACGATGACGATGACGTCCCC
GTCGCCGGCGTCATGAAACCGGACATCACCTTCTTCGGCGAACCCCTCCCCGACGAATTCTCCCGCCGTCTTACA
GAACACGATCGCGACAAGGTAGACCTCGTCGTCGTAATCGGCACCTCGCTCAAGGTAACGCCCGTCTCCGAGATC
GTCAGCTGGCTCCCACCCCACATCCCGCAAATCTACATCTCCCGCCAGCCCGTCAACCACATCAACTTCGACATC
GACCTCCTGGGAGACTGCGACGTCGTCATCGCCGAGCTGTGCCGGCGTCTGGGCTGGCCGCTTGCTCACGACATG
GCCGTTCCGGACGAGCAGCTCATCGACGTGAGGGCCGAGCCGGGATATACGAGCAGGCATGTCTTTGAGGTTCGG
AAGTCGGCGGCGGCGGATTAG
Transcript >Ophun1|2720
ATGTCGCTTACTGAGTTGGAGGAGAGGGTTAAGGATGTGAAGGAGTCGTGGGAGACGGACTCTCTGTTTGAGGAT
GCTTTTGAGGAGCTCAGCAGTGAGTCGTTGCTGGCTGCATCTGGTCCCGTCGAGGGCTGCTGCTCGCCCGAAGAA
GCCGGTCGTCTTCGGCGAGAACTGCGCGAGTACGGTCCAGCCGTCTTCTGCCAGCGGACCGTCGACGCAGGCCGA
TACACAGCCAAGAAGCTCCTAACAGCCTTCAACATCCGTCCGCCGCCCTTCCTCGACGGCGAGCTGGACAAGGCC
TACTTCGGTCTCCTCGCGCTGGCCATGACGCGCGAGTTGTCCAAGCGAGCCAAGCTTTCGCGCTGGAACTCGGTG
GACGATGCGGTCCGGCTGCTGGATCGGAGCAGTAACATCGTCGTCATTACCGGTGCTGGCATCTCTACTTCGCTT
GGCATCCCAGACTTTCGTTCCAAGGGCACCGGACTCTACTCTAAGCTGGAGCATCTTGGACTCAGTGATCCGCAG
GAGGTGTTTGACATTGAAGTCTTCAAGCAGGATCCCACCATCTTCTACTCGGTGGCAAAGGACATCGTCCCAGCA
ACAGACCGCTTCACGCCAACGCACCACTTCATCTCCATGCTCCACCACCGCAGCAAACTCCTAACCAACTACTCG
CAAAACATCGACAACCTAGAAGTCAAAGCCGGCCTCCCCCTCGACCGCCTCGTCCAATGCCACGGCTCCTTCGGC
TCAGCAACCTGCATCCAATGCGGCCACACCATGGCCGGCGACGCCATCCTCCCGCACATCAGGGCAGGACAGGTT
CCCCGCTGTCCACGATGTCTCAAGGCCTCGCTGAGGAACAACGGCGCGTCGCTCAAGAGGAAGCGCGCCTCCAAC
GCCGACAAGAAGAGGAGGAGGTGGTCGGATAGCTCGGCTGACGATGACGACGACGACGATGACGATGACGTCCCC
GTCGCCGGCGTCATGAAACCGGACATCACCTTCTTCGGCGAACCCCTCCCCGACGAATTCTCCCGCCGTCTTACA
GAACACGATCGCGACAAGGTAGACCTCGTCGTCGTAATCGGCACCTCGCTCAAGGTAACGCCCGTCTCCGAGATC
GTCAGCTGGCTCCCACCCCACATCCCGCAAATCTACATCTCCCGCCAGCCCGTCAACCACATCAACTTCGACATC
GACCTCCTGGGAGACTGCGACGTCGTCATCGCCGAGCTGTGCCGGCGTCTGGGCTGGCCGCTTGCTCACGACATG
GCCGTTCCGGACGAGCAGCTCATCGACGTGAGGGCCGAGCCGGGATATACGAGCAGGCATGTCTTTGAGGTTCGG
AAGTCGGCGGCGGCGGATTAG
Gene >Ophun1|2720
ATGTCGCTTACTGAGTTGGAGGAGAGGGTTAAGGATGTGAAGGAGTCGTGGGAGACGGACTCTCTGTTTGAGGAT
GCTTTTGAGGAGCTCAGCAGTGAGTCGTTGCTGGCTGCATCTGGTCGTGAGTTTCACCTTGTTTACTGTTGCTGT
TGTTTTTGTTGTATCTGTTCTTGTTCTTGTTGTCGTTCTTCTTCTTCCTCCTCCTCCTCCTCTTCTTGTTAATGT
TTCTGCTGACTTCAACTCCCCCTACTCCCTAGCCGTCGAGGGCTGCTGCTCGCCCGAAGAAGCCGGTCGTCTTCG
GCGAGAACTGCGCGAGTACGGTCCAGCCGTCTTCTGCCAGCGGACCGTCGACGCAGGCCGATACACAGCCAAGAA
GCTCCTAACAGCCTTCAACATCCGTCCGCCGCCCTTCCTCGACGGCGAGCTGGACAAGGCCTACTTCGGTCTCCT
CGCGCTGGCCATGACGCGCGAGTTGTCCAAGCGAGCCAAGCTTTCGCGCTGGAACTCGGTGGACGATGCGGTCCG
GCTGCTGGATCGGAGCAGTAACATCGTCGTCATTACCGGTGCTGGCATCTCTACTTCGCTTGGCATCCCAGACTT
TCGTTCCAAGGGCACCGGACTCTACTCTAAGCTGGAGCATCTTGGACTCAGTGATCCGCAGGAGGTGTTTGACAT
TGAAGTCTTCAAGCAGGATCCCACCATCTTCTACTCGGTGGCAAAGGACATCGTCCCAGCAACAGACCGCTTCAC
GCCAACGCACCACTTCATCTCCATGCTCCACCACCGCAGCAAACTCCTAACCAACTACTCGCAAAACATCGACAA
CCTAGAAGTCAAAGCCGGCCTCCCCCTCGACCGCCTCGTCCAATGCCACGGCTCCTTCGGCTCAGCAACCTGCAT
CCAATGCGGCCACACCATGGCCGGCGACGCCATCCTCCCGCACATCAGGGCAGGACAGGTTCCCCGCTGTCCACG
ATGTCTCAAGGCCTCGCTGAGGAACAACGGCGCGTCGCTCAAGAGGAAGCGCGCCTCCAACGCCGACAAGAAGAG
GAGGAGGTGGTCGGATAGCTCGGCTGACGATGACGACGACGACGATGACGATGACGTCCCCGTCGCCGGCGTCAT
GAAACCGGACATCACCTTCTTCGGCGAACCCCTCCCCGACGAATTCTCCCGCCGTCTTACAGAACACGATCGCGA
CAAGGTAGACCTCGTCGTCGTAATCGGCACCTCGCTCAAGGTAACGCCCGTCTCCGAGATCGTCAGCTGGCTCCC
ACCCCACATCCCGCAAATCTACATCTCCCGCCAGCCCGTCAACCACATCAACTTCGACATCGACCTCCTGGGAGA
CTGCGACGTCGTCATCGCCGAGCTGTGCCGGCGTCTGGGCTGGCCGCTTGCTCACGACATGGCCGTTCCGGACGA
GCAGCTCATCGACGTGAGGGCCGAGCCGGGATATACGAGCAGGCATGTCTTTGAGGTTCGGAAGTCGGCGGCGGC
GGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail