Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2714
Gene name
LocationContig_241:6554..7324
Strand-
Gene length (bp)770
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08651 DASH_Duo1 DASH complex subunit Duo1 1.9E-27 50 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74372|DUO1_SCHPO DASH complex subunit duo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=duo1 PE=3 SV=2 51 147 4.0E-13

GO

GO Term Description Terminal node
GO:0072686 mitotic spindle Yes
GO:0000278 mitotic cell cycle Yes
GO:0042729 DASH complex Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005819 spindle No
GO:0110165 cellular anatomical entity No
GO:0140513 nuclear protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0043228 non-membrane-bounded organelle No
GO:0007049 cell cycle No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3328
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6457
Ophiocordyceps australis map64 (Brazil) OphauB2|2553
Ophiocordyceps camponoti-floridani Ophcf2|01464
Ophiocordyceps camponoti-rufipedis Ophun1|2714 (this protein)
Ophiocordyceps kimflemingae Ophio5|3838
Ophiocordyceps subramaniannii Hirsu2|6155

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2714
MTDEDSLDDVWASPTQVVPSDARPKTPKTPGTPKTPSADRQPEPVDRDAALQRELEGVRGINKSIEAVLATLSRS
GDNMEVVSKTVSNASSLLNTWTRILSQTEHNQRLILHPSWKGATEDLVEQETEALEKQRQAERKAAEEEQKLQEL
RRRREEDEDKRRLGVSSSSRGVRGSSRTRGTTGRGAAGTRGGTSSTYRSDTTRPGTQSGRGPLSSRGRASSSGRG
RSRPTR*
Coding >Ophun1|2714
ATGACGGACGAAGACAGTCTCGACGACGTATGGGCGTCGCCCACGCAAGTTGTCCCTTCTGACGCCCGTCCAAAG
ACGCCCAAGACCCCTGGCACACCCAAGACGCCATCGGCCGACCGTCAGCCTGAGCCAGTCGACCGCGATGCAGCT
CTCCAGAGAGAGCTAGAGGGCGTCCGTGGCATCAATAAATCCATCGAGGCCGTCCTTGCAACCCTGAGTCGATCC
GGGGATAACATGGAGGTCGTCTCTAAAACAGTCTCCAACGCCTCCTCCCTGCTCAACACCTGGACCCGAATCCTG
TCCCAGACAGAGCACAACCAACGACTCATCCTCCACCCGAGCTGGAAAGGCGCCACCGAGGACTTGGTCGAACAG
GAGACCGAGGCGCTGGAAAAGCAGCGTCAGGCTGAACGCAAGGCCGCCGAGGAGGAGCAGAAGCTGCAAGAGCTG
CGTCGTCGGCGCGAAGAGGACGAGGACAAGAGACGGCTGGGTGTCTCGTCTTCCTCTCGCGGTGTCCGAGGCTCT
TCAAGGACACGCGGAACGACCGGTCGCGGCGCAGCCGGCACTAGAGGCGGCACAAGCTCGACTTATCGATCAGAC
ACCACCAGGCCAGGCACGCAGAGCGGACGCGGTCCCTTGTCCAGCCGCGGCCGGGCCTCTTCATCGGGTAGAGGG
CGCTCACGACCGACGAGATAG
Transcript >Ophun1|2714
ATGACGGACGAAGACAGTCTCGACGACGTATGGGCGTCGCCCACGCAAGTTGTCCCTTCTGACGCCCGTCCAAAG
ACGCCCAAGACCCCTGGCACACCCAAGACGCCATCGGCCGACCGTCAGCCTGAGCCAGTCGACCGCGATGCAGCT
CTCCAGAGAGAGCTAGAGGGCGTCCGTGGCATCAATAAATCCATCGAGGCCGTCCTTGCAACCCTGAGTCGATCC
GGGGATAACATGGAGGTCGTCTCTAAAACAGTCTCCAACGCCTCCTCCCTGCTCAACACCTGGACCCGAATCCTG
TCCCAGACAGAGCACAACCAACGACTCATCCTCCACCCGAGCTGGAAAGGCGCCACCGAGGACTTGGTCGAACAG
GAGACCGAGGCGCTGGAAAAGCAGCGTCAGGCTGAACGCAAGGCCGCCGAGGAGGAGCAGAAGCTGCAAGAGCTG
CGTCGTCGGCGCGAAGAGGACGAGGACAAGAGACGGCTGGGTGTCTCGTCTTCCTCTCGCGGTGTCCGAGGCTCT
TCAAGGACACGCGGAACGACCGGTCGCGGCGCAGCCGGCACTAGAGGCGGCACAAGCTCGACTTATCGATCAGAC
ACCACCAGGCCAGGCACGCAGAGCGGACGCGGTCCCTTGTCCAGCCGCGGCCGGGCCTCTTCATCGGGTAGAGGG
CGCTCACGACCGACGAGATAG
Gene >Ophun1|2714
ATGACGGACGAAGACAGTCTCGACGACGTATGGGCGTCGCCCACGCAAGTTGTCCCTTCTGACGCCCGTCCAAAG
ACGCCCAAGACCCCTGGCACACCCAAGACGCCATCGGCCGACCGTCAGCCTGAGCCAGTCGACCGCGATGCAGCT
CTCCAGAGAGAGCTAGAGGGCGTCCGTGGCATCAATAAATCCATCGAGGCCGTCCTTGCAACCCTGAGTCGATCC
GGGGATAACATGGAGGTAAGAGAAGCTCGCCACGATGAAAAAGAAAAGTCCCACGAGGATCGGCGGACCCCTTCT
GACCCCTCGTCCAGGTCGTCTCTAAAACAGTCTCCAACGCCTCCTCCCTGCTCAACACCTGGACCCGAATCCTGT
CCCAGACAGAGCACAACCAACGACTCATCCTCCACCCGAGCTGGAAAGGCGCCACCGAGGACTTGGTCGAACAGG
AGACCGAGGCGCTGGAAAAGCAGCGTCAGGCTGAACGCAAGGCCGCCGAGGAGGAGCAGAAGCTGCAAGAGCTGC
GTCGTCGGCGCGAAGAGGACGAGGACAAGAGACGGCTGGGTGTCTCGTCTTCCTCTCGCGGTGTCCGAGGCTCTT
CAAGGACACGCGGAACGACCGGTCGCGGCGCAGCCGGCACTAGAGGCGGCACAAGCTCGACTTATCGATCAGACA
CCACCAGGCCAGGCACGCAGAGCGGACGCGGTCCCTTGTCCAGCCGCGGCCGGGCCTCTTCATCGGGTAGAGGGC
GCTCACGACCGACGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail