Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2713
Gene name
LocationContig_241:5271..6474
Strand+
Gene length (bp)1203
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain 4.1E-46 138 307
PF17745 Ydr279_N Ydr279p protein triple barrel domain 2.2E-20 46 135

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94627|RNH2B_SCHPO Ribonuclease H2 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh202 PE=3 SV=1 43 399 8.0E-09

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6458
Ophiocordyceps australis map64 (Brazil) OphauB2|2554
Ophiocordyceps camponoti-floridani Ophcf2|01465
Ophiocordyceps camponoti-rufipedis Ophun1|2713 (this protein)
Ophiocordyceps kimflemingae Ophio5|3839
Ophiocordyceps subramaniannii Hirsu2|6156

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2713
MAPRTRTRSTKTSTTTTGKTADSIDAPAPSKFTLEASPGSAPKLFILPKLVTPEARLVLLPHPRHGRPVRYLVCP
EAGFYEVKKITAPTSSPRSWLIEHCAKASDEEDTKSGGAVADHGAQVVADPELHMATAIDPLFLMIPALGDGQPA
DKSSEKKRLFRSSDEYLDRLPDPSSHLAEILRWRNTRTLIERRMATVCDTVEAGDETMFRLNEEKLLKTMVDKAS
KMGEGGLPPSMEDKFVKRALEAPVLLSNTDATDREHPNNEASDVVANAAEVPPDVVRLQRLRTAFNFICSSYLPP
PLADKLQLQLKNSTCTDFSALEDYLAKLARLRAEAAELSSFANVSQKRSSEDEVADAQAEKKRKLEEDKQRKASE
SRGVRELKKVNTSGMKKLSHFFKKT*
Coding >Ophun1|2713
ATGGCCCCAAGGACTCGCACGAGATCGACGAAAACCAGCACCACGACGACAGGGAAGACGGCCGATTCTATAGAC
GCCCCTGCGCCCTCCAAGTTCACGCTCGAAGCCAGTCCTGGATCCGCGCCGAAGCTGTTCATCCTTCCCAAGCTC
GTCACCCCCGAGGCTCGTCTTGTTCTCCTGCCTCACCCCAGACACGGCCGACCAGTCCGCTACCTCGTCTGTCCC
GAGGCAGGCTTCTACGAGGTCAAAAAGATCACCGCACCGACATCGTCGCCCAGAAGTTGGCTCATCGAGCATTGC
GCCAAAGCGTCTGATGAGGAGGACACAAAGTCTGGCGGCGCAGTAGCAGATCATGGGGCGCAAGTCGTCGCCGAC
CCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCCTCATGATACCGGCGCTGGGGGACGGGCAGCCAGCC
GACAAATCGTCTGAGAAGAAACGTCTATTCCGGTCTAGCGACGAATATCTCGATAGATTACCGGACCCATCATCC
CATCTCGCCGAGATATTGCGATGGCGCAACACGAGGACATTGATCGAGAGACGAATGGCAACCGTTTGCGATACC
GTCGAGGCCGGCGATGAGACCATGTTTCGCCTCAACGAGGAAAAGCTTCTGAAGACGATGGTCGACAAGGCCAGC
AAGATGGGCGAAGGAGGTCTCCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCCCCGGTTCTC
CTGTCCAACACCGATGCCACCGACCGCGAACACCCGAACAACGAAGCCAGCGATGTCGTCGCCAACGCCGCTGAA
GTGCCACCGGACGTTGTACGTCTCCAGCGGCTGCGGACAGCGTTCAACTTCATCTGCTCCAGCTACCTGCCGCCA
CCTCTCGCGGACAAGCTCCAGCTGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCCCTGGAAGACTACCTT
GCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAACTGAGCTCCTTTGCCAACGTGTCTCAAAAGCGTTCGAGC
GAGGATGAAGTCGCCGACGCCCAAGCCGAGAAGAAGAGAAAGCTGGAGGAGGACAAGCAGCGAAAGGCCAGCGAG
AGTCGAGGCGTGAGGGAACTCAAAAAGGTCAACACCAGCGGGATGAAGAAGTTGAGCCACTTTTTCAAAAAAACG
TGA
Transcript >Ophun1|2713
ATGGCCCCAAGGACTCGCACGAGATCGACGAAAACCAGCACCACGACGACAGGGAAGACGGCCGATTCTATAGAC
GCCCCTGCGCCCTCCAAGTTCACGCTCGAAGCCAGTCCTGGATCCGCGCCGAAGCTGTTCATCCTTCCCAAGCTC
GTCACCCCCGAGGCTCGTCTTGTTCTCCTGCCTCACCCCAGACACGGCCGACCAGTCCGCTACCTCGTCTGTCCC
GAGGCAGGCTTCTACGAGGTCAAAAAGATCACCGCACCGACATCGTCGCCCAGAAGTTGGCTCATCGAGCATTGC
GCCAAAGCGTCTGATGAGGAGGACACAAAGTCTGGCGGCGCAGTAGCAGATCATGGGGCGCAAGTCGTCGCCGAC
CCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCCTCATGATACCGGCGCTGGGGGACGGGCAGCCAGCC
GACAAATCGTCTGAGAAGAAACGTCTATTCCGGTCTAGCGACGAATATCTCGATAGATTACCGGACCCATCATCC
CATCTCGCCGAGATATTGCGATGGCGCAACACGAGGACATTGATCGAGAGACGAATGGCAACCGTTTGCGATACC
GTCGAGGCCGGCGATGAGACCATGTTTCGCCTCAACGAGGAAAAGCTTCTGAAGACGATGGTCGACAAGGCCAGC
AAGATGGGCGAAGGAGGTCTCCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCCCCGGTTCTC
CTGTCCAACACCGATGCCACCGACCGCGAACACCCGAACAACGAAGCCAGCGATGTCGTCGCCAACGCCGCTGAA
GTGCCACCGGACGTTGTACGTCTCCAGCGGCTGCGGACAGCGTTCAACTTCATCTGCTCCAGCTACCTGCCGCCA
CCTCTCGCGGACAAGCTCCAGCTGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCCCTGGAAGACTACCTT
GCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAACTGAGCTCCTTTGCCAACGTGTCTCAAAAGCGTTCGAGC
GAGGATGAAGTCGCCGACGCCCAAGCCGAGAAGAAGAGAAAGCTGGAGGAGGACAAGCAGCGAAAGGCCAGCGAG
AGTCGAGGCGTGAGGGAACTCAAAAAGGTCAACACCAGCGGGATGAAGAAGTTGAGCCACTTTTTCAAAAAAACG
TGA
Gene >Ophun1|2713
ATGGCCCCAAGGACTCGCACGAGATCGACGAAAACCAGCACCACGACGACAGGGAAGACGGCCGATTCTATAGAC
GCCCCTGCGCCCTCCAAGTTCACGCTCGAAGCCAGTCCTGGATCCGCGCCGAAGCTGTTCATCCTTCCCAAGCTC
GTCACCCCCGAGGCTCGTCTTGTTCTCCTGCCTCACCCCAGACACGGCCGACCAGTCCGCTACCTCGTCTGTCCC
GAGGCAGGCTTCTACGAGGTCAAAAAGATCACCGCACCGACATCGTCGCCCAGAAGTTGGCTCATCGAGCATTGC
GCCAAAGCGTCTGATGAGGAGGACACAAAGTCTGGCGGCGCAGTAGCAGATCATGGGGCGCAAGTCGTCGCCGAC
CCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCCTCATGATACCGGCGCTGGGGGACGGGCAGCCAGCC
GACAAATCGTCTGAGAAGAAACGTCTATTCCGGTCTAGCGACGAATATCTCGATAGATTACCGGACCCATCATCC
CATCTCGCCGAGATATTGCGATGGCGCAACACGAGGACATTGATCGAGAGACGAATGGCAACCGTTTGCGATACC
GTCGAGGCCGGCGATGAGACCATGTTTCGCCTCAACGAGGAAAAGCTTCTGAAGACGATGGTCGACAAGGCCAGC
AAGATGGGCGAAGGAGGTCTCCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCCCCGGTTCTC
CTGTCCAACACCGATGCCACCGACCGCGAACACCCGAACAACGAAGCCAGCGATGTCGTCGCCAACGCCGCTGAA
GTGCCACCGGACGTTGTACGTCTCCAGCGGCTGCGGACAGCGTTCAACTTCATCTGCTCCAGCTACCTGCCGCCA
CCTCTCGCGGACAAGCTCCAGCTGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCCCTGGAAGACTACCTT
GCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAACTGAGCTCCTTTGCCAACGTGTCTCAAAAGCGTTCGAGC
GAGGATGAAGTCGCCGACGCCCAAGCCGAGAAGAAGAGAAAGCTGGAGGAGGACAAGCAGCGAAAGGCCAGCGAG
AGTCGAGGCGTGAGGGAACTCAAAAAGGTCAACACCAGCGGGATGAAGAAGTTGAGCCACTTTTTCAAAAAAACG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail