Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2705
Gene name
LocationContig_240:12806..15419
Strand+
Gene length (bp)2613
Transcript length (bp)2544
Coding sequence length (bp)2544
Protein length (aa) 848

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12751 Vac7 Vacuolar segregation subunit 7 1.9E-155 314 697

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53950|VAC7_YEAST Vacuolar segregation protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC7 PE=1 SV=1 596 820 3.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 618 640 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2705
MDRSPAVGDGATQQPSADDIEPTSPTPPSNTAMPHAAPKSSRHSSATTSPTPSLDSSPVTSNQPCRQQTPSLALG
RSRQTKPAETAATTTTTTISSATTPNLRPANRDPQAQQPSAPQKPPALQDLKDSHRWPVSPRLRSPPPQLSKPPA
ARRGDHDTPLISVQRPTLPPLPPDALQQPPSLDPEPDDSLMLSGIRTPIRGPLETVQEVSQNNSPAAPLNPAPSS
SAQADQVKDGKPAGPDCQSDSDGGRAHVAKASAASTHPPAAEAGTAAPRPDMQRPPALPPTPGLISRQSSAVSTK
QLKPKTEGSTQTMTVETETVPSVPQVVLSTGTKSESANGTLKAKPSAETIKPKRDKKKPARKQPPVNSGTGSSKA
DIFEAKIASAVDEANTSDSEETFVYDSNPPDNTERTNRRFHSRTPSATSMVSQADRNNLRSIYGVMEGGGHTHGP
VPKKSMKFVNTFGGGGNASDGLAPGDEDGKGTGRSAGGSARGTLRHHHHIGRWGRQPGNGHASLFDNESPFQNAA
AKSKLQPRDGSGPPPSPRIYQSARGHLSTKRSSMQMSSSYDMDDTGADDERTPLLETTARSLRGSRSRRGPHNLR
QAESQQTYTRPSSYLNRFAACLVLTIMFLLVITGAIGFMFATSQPMTDIEIVSIGNVVTSEQVLMFDLTVKAHNP
NIVVITIDHANLEIFAKSEFATPYWYADDDDARLLDDPLNDPPLGPGDDGDGDNDSRPNLLLGRVSSFDSSLTFE
GSLFHQGTSKSTAEMQLPYPGNNTFGGSARWVRIHQHEFDLIVKGVVKYSLPLSAHVRSATVAGRTTVKPNSANK
PSPKPNKTTTADVRYGASAWVG*
Coding >Ophun1|2705
ATGGACAGGTCACCGGCCGTCGGTGACGGCGCCACGCAACAACCCTCTGCCGACGACATCGAACCCACCTCGCCT
ACGCCTCCCTCCAACACCGCCATGCCGCACGCCGCCCCCAAATCGTCGAGGCACTCTTCAGCCACAACCTCTCCC
ACACCCTCTCTCGACTCCTCTCCCGTCACCAGCAACCAGCCCTGCCGCCAGCAGACGCCTTCCCTCGCCCTCGGA
CGCTCCCGCCAGACGAAGCCGGCCGAGACGGCGGCCACGACGACGACGACGACCATCTCCTCCGCCACAACCCCC
AACCTCCGTCCGGCCAATAGGGACCCTCAGGCCCAGCAGCCGTCCGCTCCCCAGAAGCCCCCGGCCCTGCAGGAC
CTCAAGGACAGTCACCGCTGGCCCGTCTCGCCCCGTCTGCGTTCTCCTCCCCCCCAGCTGTCGAAACCTCCGGCC
GCACGACGAGGCGACCACGATACTCCCCTCATCAGCGTCCAGCGGCCGACTCTCCCCCCTCTGCCTCCCGACGCA
CTACAGCAACCCCCTTCGCTCGATCCCGAACCCGATGATTCACTCATGCTGTCGGGTATCCGAACCCCCATCCGC
GGTCCACTCGAGACCGTCCAGGAGGTCAGCCAGAACAACTCTCCTGCGGCGCCTCTCAATCCAGCACCGTCGTCA
TCCGCACAAGCCGACCAGGTCAAGGACGGGAAGCCCGCCGGTCCTGATTGCCAATCGGATAGCGACGGCGGCCGC
GCCCACGTCGCAAAGGCTTCGGCCGCCTCGACGCATCCGCCGGCCGCGGAGGCTGGCACGGCCGCGCCCAGGCCC
GATATGCAGCGCCCGCCCGCCCTTCCTCCCACGCCGGGCCTCATCTCGCGCCAGTCGAGCGCCGTCTCCACCAAG
CAGCTCAAGCCCAAGACGGAGGGCTCGACGCAGACCATGACGGTCGAGACGGAGACGGTCCCAAGCGTGCCGCAG
GTGGTTCTCTCGACGGGCACCAAGTCCGAGAGCGCAAACGGGACGCTCAAGGCCAAGCCCAGCGCCGAGACGATC
AAACCCAAGAGGGACAAGAAGAAGCCGGCGCGCAAGCAACCGCCCGTCAACTCGGGAACCGGTTCGTCAAAGGCC
GACATCTTCGAGGCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCCGACTCGGAGGAGACGTTCGTCTAC
GATTCCAACCCCCCAGACAATACGGAGCGGACGAACCGCAGGTTTCACTCGCGCACGCCCAGCGCCACCTCCATG
GTCAGCCAAGCCGATCGTAACAACCTGCGATCCATCTACGGCGTCATGGAGGGCGGCGGCCACACCCACGGCCCC
GTCCCCAAGAAGAGCATGAAGTTTGTCAACACGTTTGGCGGAGGCGGCAACGCGAGCGACGGCCTGGCGCCCGGC
GACGAGGACGGCAAGGGCACCGGACGGAGCGCCGGCGGCTCGGCGCGCGGCACGCTGCGGCATCATCATCACATC
GGCAGATGGGGCCGGCAGCCCGGAAATGGCCACGCCTCCCTCTTCGATAACGAGTCGCCCTTCCAGAACGCGGCG
GCCAAATCCAAGCTTCAGCCGCGCGACGGCTCGGGCCCGCCTCCGAGTCCGAGAATCTATCAGTCGGCGCGCGGC
CACCTCAGCACCAAGCGGTCGTCGATGCAGATGTCGTCGAGCTACGATATGGACGATACGGGCGCCGATGACGAG
CGCACGCCCCTGCTCGAGACGACGGCGCGCTCCCTCAGGGGGAGCCGGAGCCGGCGCGGGCCGCACAATCTGCGC
CAGGCCGAGTCGCAGCAGACGTACACGAGGCCGTCGTCGTACCTCAACCGCTTCGCCGCCTGTCTCGTACTGACC
ATCATGTTCCTGCTCGTCATTACGGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATTGAG
ATTGTGTCTATTGGCAACGTGGTGACGAGCGAGCAGGTGCTCATGTTCGACTTGACGGTCAAGGCGCACAACCCA
AACATCGTCGTCATCACCATCGACCATGCGAATCTCGAAATCTTCGCCAAGTCGGAGTTTGCGACGCCGTACTGG
TACGCTGACGACGATGACGCCCGCCTCCTCGACGATCCCCTCAACGATCCGCCCCTTGGACCGGGCGACGATGGC
GACGGCGATAACGACAGCAGGCCGAACCTGCTACTGGGCCGCGTCTCGTCCTTTGACAGCTCCCTCACTTTCGAG
GGCTCCCTCTTTCACCAGGGAACGTCCAAGTCGACGGCGGAGATGCAGCTACCATACCCGGGCAACAACACGTTT
GGCGGCTCGGCGCGGTGGGTGCGCATCCACCAGCACGAGTTCGACCTCATCGTCAAGGGCGTCGTCAAGTACAGC
TTACCCCTGAGCGCTCACGTGCGCAGCGCCACGGTGGCTGGAAGAACGACGGTGAAGCCCAACTCGGCCAACAAG
CCGTCGCCCAAGCCTAACAAGACGACGACGGCAGATGTCCGATACGGAGCTTCCGCCTGGGTCGGGTAG
Transcript >Ophun1|2705
ATGGACAGGTCACCGGCCGTCGGTGACGGCGCCACGCAACAACCCTCTGCCGACGACATCGAACCCACCTCGCCT
ACGCCTCCCTCCAACACCGCCATGCCGCACGCCGCCCCCAAATCGTCGAGGCACTCTTCAGCCACAACCTCTCCC
ACACCCTCTCTCGACTCCTCTCCCGTCACCAGCAACCAGCCCTGCCGCCAGCAGACGCCTTCCCTCGCCCTCGGA
CGCTCCCGCCAGACGAAGCCGGCCGAGACGGCGGCCACGACGACGACGACGACCATCTCCTCCGCCACAACCCCC
AACCTCCGTCCGGCCAATAGGGACCCTCAGGCCCAGCAGCCGTCCGCTCCCCAGAAGCCCCCGGCCCTGCAGGAC
CTCAAGGACAGTCACCGCTGGCCCGTCTCGCCCCGTCTGCGTTCTCCTCCCCCCCAGCTGTCGAAACCTCCGGCC
GCACGACGAGGCGACCACGATACTCCCCTCATCAGCGTCCAGCGGCCGACTCTCCCCCCTCTGCCTCCCGACGCA
CTACAGCAACCCCCTTCGCTCGATCCCGAACCCGATGATTCACTCATGCTGTCGGGTATCCGAACCCCCATCCGC
GGTCCACTCGAGACCGTCCAGGAGGTCAGCCAGAACAACTCTCCTGCGGCGCCTCTCAATCCAGCACCGTCGTCA
TCCGCACAAGCCGACCAGGTCAAGGACGGGAAGCCCGCCGGTCCTGATTGCCAATCGGATAGCGACGGCGGCCGC
GCCCACGTCGCAAAGGCTTCGGCCGCCTCGACGCATCCGCCGGCCGCGGAGGCTGGCACGGCCGCGCCCAGGCCC
GATATGCAGCGCCCGCCCGCCCTTCCTCCCACGCCGGGCCTCATCTCGCGCCAGTCGAGCGCCGTCTCCACCAAG
CAGCTCAAGCCCAAGACGGAGGGCTCGACGCAGACCATGACGGTCGAGACGGAGACGGTCCCAAGCGTGCCGCAG
GTGGTTCTCTCGACGGGCACCAAGTCCGAGAGCGCAAACGGGACGCTCAAGGCCAAGCCCAGCGCCGAGACGATC
AAACCCAAGAGGGACAAGAAGAAGCCGGCGCGCAAGCAACCGCCCGTCAACTCGGGAACCGGTTCGTCAAAGGCC
GACATCTTCGAGGCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCCGACTCGGAGGAGACGTTCGTCTAC
GATTCCAACCCCCCAGACAATACGGAGCGGACGAACCGCAGGTTTCACTCGCGCACGCCCAGCGCCACCTCCATG
GTCAGCCAAGCCGATCGTAACAACCTGCGATCCATCTACGGCGTCATGGAGGGCGGCGGCCACACCCACGGCCCC
GTCCCCAAGAAGAGCATGAAGTTTGTCAACACGTTTGGCGGAGGCGGCAACGCGAGCGACGGCCTGGCGCCCGGC
GACGAGGACGGCAAGGGCACCGGACGGAGCGCCGGCGGCTCGGCGCGCGGCACGCTGCGGCATCATCATCACATC
GGCAGATGGGGCCGGCAGCCCGGAAATGGCCACGCCTCCCTCTTCGATAACGAGTCGCCCTTCCAGAACGCGGCG
GCCAAATCCAAGCTTCAGCCGCGCGACGGCTCGGGCCCGCCTCCGAGTCCGAGAATCTATCAGTCGGCGCGCGGC
CACCTCAGCACCAAGCGGTCGTCGATGCAGATGTCGTCGAGCTACGATATGGACGATACGGGCGCCGATGACGAG
CGCACGCCCCTGCTCGAGACGACGGCGCGCTCCCTCAGGGGGAGCCGGAGCCGGCGCGGGCCGCACAATCTGCGC
CAGGCCGAGTCGCAGCAGACGTACACGAGGCCGTCGTCGTACCTCAACCGCTTCGCCGCCTGTCTCGTACTGACC
ATCATGTTCCTGCTCGTCATTACGGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATTGAG
ATTGTGTCTATTGGCAACGTGGTGACGAGCGAGCAGGTGCTCATGTTCGACTTGACGGTCAAGGCGCACAACCCA
AACATCGTCGTCATCACCATCGACCATGCGAATCTCGAAATCTTCGCCAAGTCGGAGTTTGCGACGCCGTACTGG
TACGCTGACGACGATGACGCCCGCCTCCTCGACGATCCCCTCAACGATCCGCCCCTTGGACCGGGCGACGATGGC
GACGGCGATAACGACAGCAGGCCGAACCTGCTACTGGGCCGCGTCTCGTCCTTTGACAGCTCCCTCACTTTCGAG
GGCTCCCTCTTTCACCAGGGAACGTCCAAGTCGACGGCGGAGATGCAGCTACCATACCCGGGCAACAACACGTTT
GGCGGCTCGGCGCGGTGGGTGCGCATCCACCAGCACGAGTTCGACCTCATCGTCAAGGGCGTCGTCAAGTACAGC
TTACCCCTGAGCGCTCACGTGCGCAGCGCCACGGTGGCTGGAAGAACGACGGTGAAGCCCAACTCGGCCAACAAG
CCGTCGCCCAAGCCTAACAAGACGACGACGGCAGATGTCCGATACGGAGCTTCCGCCTGGGTCGGGTAG
Gene >Ophun1|2705
ATGGACAGGTCACCGGCCGTCGGTGACGGCGCCACGCAACAACCCTCTGCCGACGACATCGAACCCACCTCGCCT
ACGCCTCCCTCCAACACCGCCATGCCGCACGCCGCCCCCAAATCGTCGAGGCACTCTTCAGCCACAACCTCTCCC
ACACCCTCTCTCGACTCCTCTCCCGTCACCAGCAACCAGCCCTGCCGCCAGCAGACGCCTTCCCTCGCCCTCGGA
CGCTCCCGCCAGACGAAGCCGGCCGAGACGGCGGCCACGACGACGACGACGACCATCTCCTCCGCCACAACCCCC
AACCTCCGTCCGGCCAATAGGGACCCTCAGGCCCAGCAGCCGTCCGCTCCCCAGAAGCCCCCGGCCCTGCAGGAC
CTCAAGGACAGTCACCGCTGGCCCGTCTCGCCCCGTCTGCGTTCTCCTCCCCCCCAGCTGTCGAAACCTCCGGCC
GCACGACGAGGCGACCACGATACTCCCCTCATCAGCGTCCAGCGGCCGACTCTCCCCCCTCTGCCTCCCGACGCA
CTACAGCAACCCCCTTCGCTCGATCCCGAACCCGATGATTCACTCATGCTGTCGGGTATCCGAACCCCCATCCGC
GGTCCACTCGAGACCGTCCAGGAGGTCAGCCAGAACAACTCTCCTGCGGCGCCTCTCAATCCAGCACCGTCGTCA
TCCGCACAAGCCGACCAGGTCAAGGACGGGAAGCCCGCCGGTCCTGATTGCCAATCGGATAGCGACGGCGGCCGC
GCCCACGTCGCAAAGGCTTCGGCCGCCTCGACGCATCCGCCGGCCGCGGAGGCTGGCACGGCCGCGCCCAGGCCC
GATATGCAGCGCCCGCCCGCCCTTCCTCCCACGCCGGGCCTCATCTCGCGCCAGTCGAGCGCCGTCTCCACCAAG
CAGCTCAAGCCCAAGACGGAGGGCTCGACGCAGACCATGACGGTCGAGACGGAGACGGTCCCAAGCGTGCCGCAG
GTGGTTCTCTCGACGGGCACCAAGTCCGAGAGCGCAAACGGGACGCTCAAGGCCAAGCCCAGCGCCGAGACGATC
AAACCCAAGAGGGACAAGAAGAAGCCGGCGCGCAAGCAACCGCCCGTCAACTCGGGAACCGGTATGTCGGGCCGC
ACAAGTCGCCGTTTTGTGTAGCCTTTTGTTTGCTGACGTGGCGCGACTCTACCAGGTTCGTCAAAGGCCGACATC
TTCGAGGCCAAGATTGCCAGCGCCGTCGACGAGGCCAACACGTCCGACTCGGAGGAGACGTTCGTCTACGATTCC
AACCCCCCAGACAATACGGAGCGGACGAACCGCAGGTTTCACTCGCGCACGCCCAGCGCCACCTCCATGGTCAGC
CAAGCCGATCGTAACAACCTGCGATCCATCTACGGCGTCATGGAGGGCGGCGGCCACACCCACGGCCCCGTCCCC
AAGAAGAGCATGAAGTTTGTCAACACGTTTGGCGGAGGCGGCAACGCGAGCGACGGCCTGGCGCCCGGCGACGAG
GACGGCAAGGGCACCGGACGGAGCGCCGGCGGCTCGGCGCGCGGCACGCTGCGGCATCATCATCACATCGGCAGA
TGGGGCCGGCAGCCCGGAAATGGCCACGCCTCCCTCTTCGATAACGAGTCGCCCTTCCAGAACGCGGCGGCCAAA
TCCAAGCTTCAGCCGCGCGACGGCTCGGGCCCGCCTCCGAGTCCGAGAATCTATCAGTCGGCGCGCGGCCACCTC
AGCACCAAGCGGTCGTCGATGCAGATGTCGTCGAGCTACGATATGGACGATACGGGCGCCGATGACGAGCGCACG
CCCCTGCTCGAGACGACGGCGCGCTCCCTCAGGGGGAGCCGGAGCCGGCGCGGGCCGCACAATCTGCGCCAGGCC
GAGTCGCAGCAGACGTACACGAGGCCGTCGTCGTACCTCAACCGCTTCGCCGCCTGTCTCGTACTGACCATCATG
TTCCTGCTCGTCATTACGGGCGCCATCGGCTTCATGTTTGCCACGTCGCAGCCCATGACGGACATTGAGATTGTG
TCTATTGGCAACGTGGTGACGAGCGAGCAGGTGCTCATGTTCGACTTGACGGTCAAGGCGCACAACCCAAACATC
GTCGTCATCACCATCGACCATGCGAATCTCGAAATCTTCGCCAAGTCGGAGTTTGCGACGCCGTACTGGTACGCT
GACGACGATGACGCCCGCCTCCTCGACGATCCCCTCAACGATCCGCCCCTTGGACCGGGCGACGATGGCGACGGC
GATAACGACAGCAGGCCGAACCTGCTACTGGGCCGCGTCTCGTCCTTTGACAGCTCCCTCACTTTCGAGGGCTCC
CTCTTTCACCAGGGAACGTCCAAGTCGACGGCGGAGATGCAGCTACCATACCCGGGCAACAACACGTTTGGCGGC
TCGGCGCGGTGGGTGCGCATCCACCAGCACGAGTTCGACCTCATCGTCAAGGGCGTCGTCAAGTACAGCTTACCC
CTGAGCGCTCACGTGCGCAGCGCCACGGTGGCTGGAAGAACGACGGTGAAGCCCAACTCGGCCAACAAGCCGTCG
CCCAAGCCTAACAAGACGACGACGGCAGATGTCCGATACGGAGCTTCCGCCTGGGTCGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail