Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2702
Gene name
LocationContig_240:5811..6910
Strand-
Gene length (bp)1099
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e 2.4E-35 80 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09127|RL10A_SCHPO 60S ribosomal protein L10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1001 PE=2 SV=2 69 284 2.0E-121
sp|Q9P769|RL10B_SCHPO 60S ribosomal protein L10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1002 PE=3 SV=1 69 284 3.0E-121
sp|P41805|RL10_YEAST 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 69 289 2.0E-118
sp|O96647|RL10_BOMMA 60S ribosomal protein L10 OS=Bombyx mandarina GN=RpL10 PE=2 SV=1 69 274 6.0E-109
sp|O61231|RL10_DROME 60S ribosomal protein L10 OS=Drosophila melanogaster GN=RpL10 PE=1 SV=1 69 275 6.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09127|RL10A_SCHPO 60S ribosomal protein L10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1001 PE=2 SV=2 69 284 2.0E-121
sp|Q9P769|RL10B_SCHPO 60S ribosomal protein L10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1002 PE=3 SV=1 69 284 3.0E-121
sp|P41805|RL10_YEAST 60S ribosomal protein L10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL10 PE=1 SV=1 69 289 2.0E-118
sp|O96647|RL10_BOMMA 60S ribosomal protein L10 OS=Bombyx mandarina GN=RpL10 PE=2 SV=1 69 274 6.0E-109
sp|O61231|RL10_DROME 60S ribosomal protein L10 OS=Drosophila melanogaster GN=RpL10 PE=1 SV=1 69 275 6.0E-108
sp|Q54J69|RL10_DICDI 60S ribosomal protein L10 OS=Dictyostelium discoideum GN=rpl10 PE=1 SV=2 69 275 3.0E-106
sp|P86048|RL10L_MOUSE 60S ribosomal protein L10-like OS=Mus musculus GN=Rpl10l PE=2 SV=1 69 274 1.0E-105
sp|Q2TBW8|RL10L_BOVIN 60S ribosomal protein L10-like OS=Bos taurus GN=RPL10L PE=2 SV=1 69 274 1.0E-105
sp|Q4R4D3|RL10L_MACFA 60S ribosomal protein L10-like OS=Macaca fascicularis GN=RPL10L PE=2 SV=1 69 274 2.0E-105
sp|Q6PDV7|RL10_RAT 60S ribosomal protein L10 OS=Rattus norvegicus GN=Rpl10 PE=1 SV=3 69 274 3.0E-105
sp|A9CB60|RL10_PAPAN 60S ribosomal protein L10 OS=Papio anubis GN=RPL10 PE=3 SV=1 69 274 3.0E-105
sp|Q6ZWV3|RL10_MOUSE 60S ribosomal protein L10 OS=Mus musculus GN=Rpl10 PE=1 SV=3 69 274 3.0E-105
sp|P27635|RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 69 274 3.0E-105
sp|Q29195|RL10_PIG 60S ribosomal protein L10 OS=Sus scrofa GN=RPL10 PE=1 SV=3 69 274 7.0E-105
sp|Q9XSI3|RL10_BOVIN 60S ribosomal protein L10 OS=Bos taurus GN=RPL10 PE=2 SV=4 69 274 7.0E-105
sp|A8D8X1|RL10_SHEEP 60S ribosomal protein L10 OS=Ovis aries GN=RPL10 PE=2 SV=1 69 274 7.0E-105
sp|Q5R931|RL10_PONAB 60S ribosomal protein L10 OS=Pongo abelii GN=RPL10 PE=2 SV=3 69 274 9.0E-105
sp|Q4R7Y2|RL10_MACFA 60S ribosomal protein L10 OS=Macaca fascicularis GN=RPL10 PE=2 SV=1 69 274 4.0E-103
sp|Q96L21|RL10L_HUMAN 60S ribosomal protein L10-like OS=Homo sapiens GN=RPL10L PE=1 SV=3 69 274 4.0E-102
sp|Q09533|RL10_CAEEL 60S ribosomal protein L10 OS=Caenorhabditis elegans GN=rpl-10 PE=3 SV=1 69 275 2.0E-101
sp|Q08200|RL10_CHICK 60S ribosomal protein L10 (Fragment) OS=Gallus gallus GN=RPL10 PE=2 SV=1 75 274 3.0E-101
sp|Q0ITS8|RL101_ORYSJ 60S ribosomal protein L10-1 OS=Oryza sativa subsp. japonica GN=SC34 PE=2 SV=1 69 275 4.0E-101
sp|A2ZCQ7|RL101_ORYSI 60S ribosomal protein L10-1 OS=Oryza sativa subsp. indica GN=SC34 PE=2 SV=2 69 275 4.0E-101
sp|P45633|RL10_MAIZE 60S ribosomal protein L10 OS=Zea mays GN=RPL10 PE=2 SV=1 69 274 2.0E-99
sp|P93847|RL10_SOLME 60S ribosomal protein L10 OS=Solanum melongena GN=RPL10 PE=2 SV=1 69 275 6.0E-99
sp|Q93W22|RL103_ARATH 60S ribosomal protein L10-3 OS=Arabidopsis thaliana GN=RPL10C PE=2 SV=1 69 276 6.0E-97
sp|Q9M5M7|RL10_EUPES 60S ribosomal protein L10 OS=Euphorbia esula GN=RPL10 PE=2 SV=1 69 276 6.0E-97
sp|Q9SPB3|RL10_VITRI 60S ribosomal protein L10 OS=Vitis riparia GN=RPL10 PE=2 SV=1 69 276 8.0E-97
sp|Q08770|RL102_ARATH 60S ribosomal protein L10-2 OS=Arabidopsis thaliana GN=RPL10B PE=2 SV=2 69 276 4.0E-95
sp|Q0DKF0|RL102_ORYSJ 60S ribosomal protein L10-2 OS=Oryza sativa subsp. japonica GN=SG12 PE=2 SV=1 69 275 7.0E-95
sp|A2Y0T4|RL102_ORYSI 60S ribosomal protein L10-2 OS=Oryza sativa subsp. indica GN=SG12 PE=2 SV=2 69 275 7.0E-95
sp|Q93VT9|RL101_ARATH 60S ribosomal protein L10-1 OS=Arabidopsis thaliana GN=RPL10A PE=1 SV=1 69 276 1.0E-94
sp|O22431|RL10_PINTA 60S ribosomal protein L10 OS=Pinus taeda GN=RPL10 PE=2 SV=1 69 276 8.0E-94
sp|Q39724|RL10_EUGGR 60S ribosomal protein L10 OS=Euglena gracilis GN=RPL10 PE=2 SV=1 69 274 3.0E-90
sp|Q8SR96|RL10_ENCCU 60S ribosomal protein L10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL10 PE=1 SV=1 69 280 3.0E-85
sp|Q235M8|RL10_TETTS 60S ribosomal protein L10 OS=Tetrahymena thermophila (strain SB210) GN=RPL10 PE=1 SV=1 69 275 9.0E-83
sp|Q40592|RL10_TOBAC 60S ribosomal protein L10 (Fragment) OS=Nicotiana tabacum GN=RPL10 PE=2 SV=1 148 284 2.0E-51
sp|Q8TYP2|RL10E_METKA 50S ribosomal protein L10e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10e PE=3 SV=1 69 237 2.0E-42
sp|Q9YEY5|RL10E_AERPE 50S ribosomal protein L10e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl10e PE=3 SV=1 69 235 3.0E-39
sp|A3DM76|RL10E_STAMF 50S ribosomal protein L10e OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl10e PE=3 SV=1 69 245 5.0E-39
sp|O28930|RL10E_ARCFU 50S ribosomal protein L10e OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl10e PE=3 SV=1 69 238 9.0E-39
sp|B1YDH6|RL10E_PYRNV 50S ribosomal protein L10e OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl10e PE=3 SV=1 69 236 2.0E-36
sp|Q57963|RL10E_METJA 50S ribosomal protein L10e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl10e PE=3 SV=1 72 237 7.0E-36
sp|A3MXP3|RL10E_PYRCJ 50S ribosomal protein L10e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl10e PE=3 SV=1 69 236 1.0E-35
sp|A4WN05|RL10E_PYRAR 50S ribosomal protein L10e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl10e PE=3 SV=1 69 236 2.0E-35
sp|A6USY4|RL10E_META3 50S ribosomal protein L10e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl10e PE=3 SV=1 69 237 8.0E-35
sp|Q12W43|RL10E_METBU 50S ribosomal protein L10e OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl10e PE=3 SV=1 69 237 1.0E-34
sp|A1RT11|RL10E_PYRIL 50S ribosomal protein L10e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl10e PE=3 SV=1 69 236 2.0E-34
sp|A2BNA6|RL10E_HYPBU 50S ribosomal protein L10e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl10e PE=3 SV=1 69 228 2.0E-34
sp|A1RXM2|RL10E_THEPD 50S ribosomal protein L10e OS=Thermofilum pendens (strain Hrk 5) GN=rpl10e PE=3 SV=1 69 237 2.0E-33
sp|Q8ZSV4|RL10E_PYRAE 50S ribosomal protein L10e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl10e PE=3 SV=1 69 236 2.0E-33
sp|Q0W389|RL10E_METAR 50S ribosomal protein L10e OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl10e PE=3 SV=1 69 237 5.0E-33
sp|Q6LXR0|RL10E_METMP 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl10e PE=3 SV=1 69 237 5.0E-33
sp|Q4JC84|RL10E_SULAC 50S ribosomal protein L10e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl10e PE=3 SV=1 69 236 7.0E-33
sp|A6VGM6|RL10E_METM7 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl10e PE=3 SV=1 69 237 1.0E-32
sp|A9AA25|RL10E_METM6 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl10e PE=3 SV=1 69 237 1.0E-32
sp|A3CTT1|RL10E_METMJ 50S ribosomal protein L10e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl10e PE=3 SV=1 69 234 1.0E-32
sp|A4FWP5|RL10E_METM5 50S ribosomal protein L10e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl10e PE=3 SV=1 69 237 3.0E-32
sp|A2SQE9|RL10E_METLZ 50S ribosomal protein L10e OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl10e PE=3 SV=1 69 236 4.0E-32
sp|A4YHV3|RL10E_METS5 50S ribosomal protein L10e OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl10e PE=3 SV=1 69 247 6.0E-32
sp|Q6L152|RL10E_PICTO 50S ribosomal protein L10e OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl10e PE=3 SV=1 69 242 6.0E-32
sp|Q9HJB3|RL10E_THEAC 50S ribosomal protein L10e OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl10e PE=3 SV=2 69 238 9.0E-32
sp|Q8PWV0|RL10E_METMA 50S ribosomal protein L10e OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl10e PE=3 SV=1 69 237 4.0E-31
sp|Q8TU90|RL10E_METAC 50S ribosomal protein L10e OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl10e PE=3 SV=1 69 237 4.0E-31
sp|P58299|RL10E_THEVO 50S ribosomal protein L10e OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl10e PE=3 SV=1 69 238 1.0E-30
sp|C6A4T2|RL10E_THESM 50S ribosomal protein L10e OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl10e PE=3 SV=1 69 228 2.0E-30
sp|O27191|RL10E_METTH 50S ribosomal protein L10e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl10e PE=3 SV=1 85 237 2.0E-30
sp|Q46CR0|RL10E_METBF 50S ribosomal protein L10e OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl10e PE=3 SV=1 69 237 2.0E-30
sp|Q9UWP5|RL10E_PYRFU 50S ribosomal protein L10e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl10e PE=1 SV=1 69 228 3.0E-30
sp|B8GH15|RL10E_METPE 50S ribosomal protein L10e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl10e PE=3 SV=1 69 237 5.0E-30
sp|O58367|RL10E_PYRHO 50S ribosomal protein L10e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl10e PE=3 SV=1 69 228 5.0E-30
sp|Q96YA4|RL10E_SULTO 50S ribosomal protein L10e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl10e PE=3 SV=2 69 235 5.0E-30
sp|Q9UYU9|RL10E_PYRAB 50S ribosomal protein L10e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl10e PE=3 SV=1 69 228 2.0E-29
sp|C3N7I5|RL10E_SULIY 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|C3NFZ1|RL10E_SULIN 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|C3MXL7|RL10E_SULIM 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|C3MRC8|RL10E_SULIL 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|C4KIP3|RL10E_SULIK 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|C3MZG3|RL10E_SULIA 50S ribosomal protein L10e OS=Sulfolobus islandicus (strain M.16.27) GN=rpl10e PE=3 SV=1 69 247 2.0E-29
sp|Q2NHZ0|RL10E_METST 50S ribosomal protein L10e OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl10e PE=3 SV=1 83 237 3.0E-29
sp|B6YSL0|RL10E_THEON 50S ribosomal protein L10e OS=Thermococcus onnurineus (strain NA1) GN=rpl10e PE=3 SV=1 69 228 9.0E-29
sp|Q2FLD3|RL10E_METHJ 50S ribosomal protein L10e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl10e PE=3 SV=1 69 235 2.0E-28
sp|Q980J7|RL10E_SULSO 50S ribosomal protein L10e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl10e PE=3 SV=1 69 235 3.0E-28
sp|A8MDE4|RL10E_CALMQ 50S ribosomal protein L10e OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl10e PE=3 SV=1 69 228 2.0E-27
sp|P60617|RL10E_HALMA 50S ribosomal protein L10e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10e PE=1 SV=2 69 227 2.0E-27
sp|C5A293|RL10E_THEGJ 50S ribosomal protein L10e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl10e PE=3 SV=1 69 228 2.0E-27
sp|Q9HSS4|RL10E_HALSA 50S ribosomal protein L10e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10e PE=3 SV=1 69 237 5.0E-27
sp|B0R2M5|RL10E_HALS3 50S ribosomal protein L10e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10e PE=3 SV=1 69 237 5.0E-27
sp|Q5JDI6|RL10E_THEKO 50S ribosomal protein L10e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl10e PE=3 SV=1 69 228 1.0E-26
sp|B9LQR1|RL10E_HALLT 50S ribosomal protein L10e OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl10e PE=3 SV=1 69 237 5.0E-26
sp|Q18KD2|RL10E_HALWD 50S ribosomal protein L10e OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl10e PE=3 SV=1 69 236 2.0E-23
sp|Q3IU82|RL10E_NATPD 50S ribosomal protein L10e OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl10e PE=3 SV=1 69 227 3.0E-23
sp|Q74M84|RL10E_NANEQ 50S ribosomal protein L10e OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl10e PE=3 SV=1 69 232 7.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1875
Ophiocordyceps australis map64 (Brazil) OphauB2|7351
Ophiocordyceps camponoti-floridani Ophcf2|02018
Ophiocordyceps camponoti-rufipedis Ophun1|2702 (this protein)
Ophiocordyceps kimflemingae Ophio5|6601
Ophiocordyceps subramaniannii Hirsu2|9173

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2702
MDWKIFAQFDTTNFRRATGHQVVLTKPALKSNLVRRGQRQTKPVPQVGLQLFPLLITTSGHGSANLDKMARRPAR
CYRYCKNKPFPKSRFNRGVPDPKIRIFDLGRKRANVDDFPLCIHLVSNEYEQLSSEALEAARICANKYLVKHTGK
EGFHLRVRAHPFHVVRINKMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQIIMSVRTRDSSRALALEALRRSQY
KFPGRQKIIISKNWGFTPLRREDYLERKAAGRVKVDGAYVQFLSNHGRLADNMRRFPEAFQSQA*
Coding >Ophun1|2702
ATGGACTGGAAGATTTTCGCTCAGTTTGATACGACCAACTTTCGGCGGGCGACCGGCCACCAAGTCGTGCTTACC
AAGCCTGCTTTGAAATCCAATCTGGTGCGCAGAGGGCAGAGACAGACCAAGCCCGTGCCTCAGGTCGGACTTCAA
CTCTTCCCCCTTCTCATCACCACTTCCGGGCACGGCTCAGCAAATTTGGACAAGATGGCCCGTCGTCCTGCCCGC
TGCTACCGCTACTGCAAGAACAAGCCGTTCCCCAAGTCGCGGTTCAACCGTGGTGTTCCGGATCCGAAAATCAGA
ATCTTCGATCTCGGCCGCAAGCGCGCCAACGTGGACGACTTCCCTCTCTGCATCCACCTCGTCTCCAACGAGTAT
GAGCAGCTGAGCTCCGAGGCTCTCGAGGCCGCCCGCATCTGCGCCAACAAGTACCTAGTCAAGCACACTGGCAAG
GAGGGTTTCCATCTCCGCGTCCGCGCCCACCCTTTCCACGTCGTTCGTATCAACAAAATGTTGTCGTGCGCCGGC
GCCGATAGACTGCAGACGGGTATGCGCGGTGCATGGGGCAAGCCCAACGGCACTGTCGCCCGTGTCAATATTGGC
CAGATCATCATGAGCGTCCGCACTCGCGATTCGAGCCGAGCTCTCGCCCTCGAGGCCCTGCGCCGATCGCAGTAC
AAGTTCCCCGGCCGCCAAAAGATCATCATCTCCAAGAACTGGGGCTTCACCCCCTTGCGTCGCGAGGACTACCTC
GAGCGCAAGGCTGCGGGCCGCGTCAAGGTAGACGGTGCCTACGTACAGTTCCTCAGCAACCACGGTCGTTTGGCA
GACAACATGCGGCGCTTCCCCGAAGCGTTTCAGTCCCAGGCTTGA
Transcript >Ophun1|2702
ATGGACTGGAAGATTTTCGCTCAGTTTGATACGACCAACTTTCGGCGGGCGACCGGCCACCAAGTCGTGCTTACC
AAGCCTGCTTTGAAATCCAATCTGGTGCGCAGAGGGCAGAGACAGACCAAGCCCGTGCCTCAGGTCGGACTTCAA
CTCTTCCCCCTTCTCATCACCACTTCCGGGCACGGCTCAGCAAATTTGGACAAGATGGCCCGTCGTCCTGCCCGC
TGCTACCGCTACTGCAAGAACAAGCCGTTCCCCAAGTCGCGGTTCAACCGTGGTGTTCCGGATCCGAAAATCAGA
ATCTTCGATCTCGGCCGCAAGCGCGCCAACGTGGACGACTTCCCTCTCTGCATCCACCTCGTCTCCAACGAGTAT
GAGCAGCTGAGCTCCGAGGCTCTCGAGGCCGCCCGCATCTGCGCCAACAAGTACCTAGTCAAGCACACTGGCAAG
GAGGGTTTCCATCTCCGCGTCCGCGCCCACCCTTTCCACGTCGTTCGTATCAACAAAATGTTGTCGTGCGCCGGC
GCCGATAGACTGCAGACGGGTATGCGCGGTGCATGGGGCAAGCCCAACGGCACTGTCGCCCGTGTCAATATTGGC
CAGATCATCATGAGCGTCCGCACTCGCGATTCGAGCCGAGCTCTCGCCCTCGAGGCCCTGCGCCGATCGCAGTAC
AAGTTCCCCGGCCGCCAAAAGATCATCATCTCCAAGAACTGGGGCTTCACCCCCTTGCGTCGCGAGGACTACCTC
GAGCGCAAGGCTGCGGGCCGCGTCAAGGTAGACGGTGCCTACGTACAGTTCCTCAGCAACCACGGTCGTTTGGCA
GACAACATGCGGCGCTTCCCCGAAGCGTTTCAGTCCCAGGCTTGA
Gene >Ophun1|2702
ATGGACTGGAAGATTTTCGCTCAGTTTGATACGACCAACTTTCGGCGGGTCAGGGCTTGGTAGGCGATGCCGGCC
AATCGTGGCTGCGCCATGCCCCGATCTAAGCCCTAAAGCGCCGGAGTTTAGGCGACCGGCCACCAAGTCGTGCTT
ACCAAGCCTGCTTTGAAATCCAATCTGGTGCGCAGAGGGCAGAGACAGACCAAGCCCGTGCCTCAGGTCGGACTT
CAACTCTTCCCCCTTCTCATCACCACTTCCGGGCACGGCTCAGCAAATTTGGACAAGATGGCCCGTCGTCCTGCC
CGCTGCTACCGCTACTGCAAGAACAAGGTGAGCCTCGAAACGGGCGACGAGGGTTGAAGAAGCCGGACTCGCGGT
TGTTGGAAAAACGCAGCATCGGCCCTGGCTGACCGCTCCGATAGCCGTTCCCCAAGTCGCGGTTCAACCGTGGTG
TTCCGGATCCGAAAATCAGAATCTTCGATCTCGGCCGCAAGCGCGCCAACGTGGACGACTTCCCTCTCTGCATCC
ACCTCGTCTCCAACGAGTATGAGCAGCTGAGCTCCGAGGCTCTCGAGGCCGCCCGCATCTGCGCCAACAAGTACC
TAGTCAAGCACACTGGCAAGGAGGGTTTCCATCTCCGCGTCCGCGCCCACCCTTTCCACGTCGTTCGTATCAACA
AAATGTTGTCGTGCGCCGGCGCCGATAGACTGCAGACGGGTATGCGCGGTGCATGGGGCAAGCCCAACGGCACTG
TCGCCCGTGTCAATATTGGCCAGATCATCATGAGCGTCCGCACTCGCGATTCGAGTACGTTTATCGGGTTCAGTA
TCAGGAGATGAGTCGCAGCCGCTAACACGATGATGCAGGCCGAGCTCTCGCCCTCGAGGCCCTGCGCCGATCGCA
GTACAAGTTCCCCGGCCGCCAAAAGATCATCATCTCCAAGAACTGGGGCTTCACCCCCTTGCGTCGCGAGGACTA
CCTCGAGCGCAAGGCTGCGGGCCGCGTCAAGGTAGACGGTGCCTACGTACAGTTCCTCAGCAACCACGGTCGTTT
GGCAGACAACATGCGGCGCTTCCCCGAAGCGTTTCAGTCCCAGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail