Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2698
Gene name
LocationContig_24:61963..62452
Strand-
Gene length (bp)489
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17233 DUF5308 Family of unknown function (DUF5308) 1.0E-40 9 148

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7268
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00736
Ophiocordyceps camponoti-rufipedis Ophun1|2698 (this protein)
Ophiocordyceps kimflemingae Ophio5|2750

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2698
MANLPSQHPSLAIHLSDLTLTPLISSSSSASNVGSLSALASSAVATRTSAQRAHLGRPQRVMVEYSDRGPVVLHT
FLDPGDVLVSPAEHHGPDANQPHDNGHLNNKDQPQDPCPVLVGLVVAADADEAPEARRAAAKLERIARDFQRQWS
DHQTAESRSSSK*
Coding >Ophun1|2698
ATGGCAAATCTCCCCTCCCAACACCCTTCCCTCGCCATCCATCTCTCCGACCTGACCCTCACCCCGCTCATCTCG
TCGTCCTCGTCCGCTTCCAATGTCGGCTCCCTTTCGGCCCTCGCCTCCAGTGCCGTCGCCACCCGCACCTCGGCC
CAGCGCGCTCACCTCGGCCGACCCCAGCGCGTCATGGTCGAGTATTCGGATAGGGGCCCTGTCGTCCTCCATACT
TTCCTCGACCCCGGCGACGTCTTGGTCTCTCCCGCCGAACATCATGGTCCTGACGCCAACCAACCTCACGACAAC
GGCCATCTTAATAATAAAGATCAACCCCAAGACCCTTGCCCCGTCCTCGTCGGCCTCGTCGTCGCTGCTGATGCC
GACGAAGCCCCCGAGGCCCGCCGTGCCGCCGCCAAACTCGAGCGCATCGCCCGAGACTTTCAGCGCCAGTGGTCC
GACCACCAGACCGCAGAAAGCCGATCCAGTAGCAAGTGA
Transcript >Ophun1|2698
ATGGCAAATCTCCCCTCCCAACACCCTTCCCTCGCCATCCATCTCTCCGACCTGACCCTCACCCCGCTCATCTCG
TCGTCCTCGTCCGCTTCCAATGTCGGCTCCCTTTCGGCCCTCGCCTCCAGTGCCGTCGCCACCCGCACCTCGGCC
CAGCGCGCTCACCTCGGCCGACCCCAGCGCGTCATGGTCGAGTATTCGGATAGGGGCCCTGTCGTCCTCCATACT
TTCCTCGACCCCGGCGACGTCTTGGTCTCTCCCGCCGAACATCATGGTCCTGACGCCAACCAACCTCACGACAAC
GGCCATCTTAATAATAAAGATCAACCCCAAGACCCTTGCCCCGTCCTCGTCGGCCTCGTCGTCGCTGCTGATGCC
GACGAAGCCCCCGAGGCCCGCCGTGCCGCCGCCAAACTCGAGCGCATCGCCCGAGACTTTCAGCGCCAGTGGTCC
GACCACCAGACCGCAGAAAGCCGATCCAGTAGCAAGTGA
Gene >Ophun1|2698
ATGGCAAATCTCCCCTCCCAACACCCTTCCCTCGCCATCCATCTCTCCGACCTGACCCTCACCCCGCTCATCTCG
TCGTCCTCGTCCGCTTCCAATGTCGGCTCCCTTTCGGCCCTCGCCTCCAGTGCCGTCGCCACCCGCACCTCGGCC
CAGCGCGCTCACCTCGGCCGACCCCAGCGCGTCATGGTCGAGTATTCGGATAGGGGCCCTGTCGTCCTCCATACT
TTCCTCGACCCCGGCGACGTCTTGGTCTCTCCCGCCGAACATCATGGTCCTGACGCCAACCAACCTCACGACAAC
GGCCATCTTAATAATAAAGATCAACCCCAAGACCCTTGCCCCGTCCTCGTCGGCCTCGTCGTCGCTGCTGATGCC
GACGAAGCCCCCGAGGCCCGCCGTGCCGCCGCCAAACTCGAGCGCATCGCCCGAGACTTTCAGCGCCAGTGGTCC
GACCACCAGACCGCAGAAAGCCGATCCAGTAGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail