Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2695
Gene name
LocationContig_24:54978..57873
Strand+
Gene length (bp)2895
Transcript length (bp)2781
Coding sequence length (bp)2781
Protein length (aa) 927

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 3.0E-90 63 505
PF12456 hSac2 Inositol phosphatase 1.5E-39 673 787

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 235 762 8.0E-87
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 243 762 3.0E-82
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 243 762 1.0E-81
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 246 656 1.0E-59
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 246 667 1.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 235 762 8.0E-87
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 243 762 3.0E-82
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 243 762 1.0E-81
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 246 656 1.0E-59
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 246 667 1.0E-58
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 250 667 2.0E-57
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 250 667 3.0E-57
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 249 655 2.0E-56
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 246 667 5.0E-56
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 246 658 7.0E-56
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 246 658 7.0E-56
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 246 671 8.0E-56
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 250 656 2.0E-55
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 246 658 4.0E-54
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 246 658 5.0E-53
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 250 669 8.0E-53
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 249 656 9.0E-53
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 247 655 3.0E-50
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 246 657 7.0E-44
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 247 658 8.0E-41
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 249 738 3.0E-38
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 246 657 1.0E-36
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 252 643 2.0E-35
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 360 677 4.0E-34
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 352 654 4.0E-34
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 211 654 5.0E-34
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 360 671 6.0E-34
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 360 702 6.0E-34
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 352 654 1.0E-33
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 196 655 2.0E-33
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 360 702 5.0E-33
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 247 658 1.0E-32
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 204 682 7.0E-31
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 221 655 3.0E-30
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 247 655 3.0E-29
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 221 655 8.0E-29
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 247 655 8.0E-27
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 247 519 4.0E-22
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 358 655 4.0E-21
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 540 655 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5674
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4103
Ophiocordyceps australis map64 (Brazil) OphauB2|2002
Ophiocordyceps camponoti-floridani Ophcf2|00733
Ophiocordyceps camponoti-rufipedis Ophun1|2695 (this protein)
Ophiocordyceps kimflemingae Ophio5|2747
Ophiocordyceps subramaniannii Hirsu2|828

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2695
MPGIARKIVVCAAIDGLIVQPVSSKGQRAYQPVRVKYDDSSVSAVPRDQIPDRTEPEESFEAFGIIGLITVSKLS
YLITIVRRQQVAQIRGCPVFVVTDVAVTPCTSQSDAIESIRQTAKLLQARSPDTRSEAAESSDGDADASDRVQDD
DADSEIDAAKPEAERSSVAEDVIRRRGSYGRFAQSWFSNSGWTMDQRRSMGMSISSPVPAPDSEEAPAAAEDVHV
SSPVSALLPKLLRFVKVIFGSSRSFYFSYDVDVTRSLAQNLLLFGRDAPLHAQVDADFFWNRHILRPFVVTGQDA
LALPVMQGFVGQRAFVVDTDPPQLDETTAESLEMHNLPSSGEGRASSELRPSERRYLVTLVSRRSTKRAGLRYLR
RGVNEDGFTANMVETEQLLSSASWDQSRPTSSFLQVRGSIPLYFTQSAYSLKPVPVIQHSVESNLKACRKHFERL
SKAYGLLQVVSLVEKTGIEEPIGSQYQTSVDRLNEGLRQPDKIPFEWFDFHQACRGMKFENVSQLLLRLKDRLEE
LGTTTQRQGELTQKQKGVVRTNCMDCLDRTNVCQSSFAKYMLDHALKEDGVDMSAQLDQETAWFNTLWADNGDAV
SKQYASTAAMKGDYTRTRKRDYRGALNDLGLSLARFYSGMVNDYFGQAAIDFLLGNVTSKIFDEFEADMMTKDPA
VSISNMRQRAVELCRKRVVADEREEFHGGWVLLSPNAADVVKSWSMDEVVLLLTDAAVYLCRFDWDLDKVSSFER
VHLANVTSIKQGTYITSTVSPAHMDEERNVGFVIEYQPGKSNIQRTNTRTLSSRSEFGPGKTDVQNCDGSYRQTG
FGNLFSAKTKSRSARRLALKAPYANSSASAPESVPCQTEKQLVTAICAEIERLALERQFRKEGDGGKSIVEKGDV
ISLEAAKRNTGLLEQLGHSIKKLVWA*
Coding >Ophun1|2695
ATGCCTGGGATCGCACGAAAGATTGTCGTCTGCGCGGCCATCGACGGCCTGATAGTCCAGCCGGTCTCGTCCAAG
GGCCAGCGGGCCTATCAGCCCGTTCGGGTCAAATACGACGACTCTTCCGTCTCGGCCGTGCCTCGAGATCAGATT
CCTGATAGGACCGAGCCGGAGGAGTCGTTCGAGGCCTTTGGCATCATCGGCCTCATCACCGTGTCGAAACTGAGC
TATCTCATCACCATCGTCCGCCGCCAGCAGGTGGCTCAGATCCGAGGCTGTCCCGTCTTCGTCGTCACAGACGTT
GCCGTCACTCCCTGCACGTCGCAGTCGGATGCCATCGAATCCATCCGTCAGACGGCGAAGCTGCTGCAGGCCCGT
TCCCCGGACACCCGAAGCGAGGCCGCCGAGAGCAGCGACGGAGACGCCGACGCGTCCGATCGAGTCCAAGACGAT
GATGCCGACAGCGAGATCGACGCTGCAAAGCCGGAAGCCGAGCGCAGCAGCGTCGCCGAGGACGTCATCCGTCGA
CGCGGGAGCTACGGGAGGTTCGCGCAGAGCTGGTTCAGCAACAGCGGATGGACCATGGATCAGCGTCGCAGCATG
GGCATGAGCATATCCTCGCCCGTCCCGGCTCCGGACTCGGAAGAGGCTCCGGCCGCCGCCGAAGACGTCCATGTG
TCATCACCCGTGTCGGCGCTGCTTCCCAAGCTCTTGCGCTTCGTCAAGGTCATCTTCGGCTCTTCGCGAAGCTTC
TACTTTTCGTACGACGTCGATGTGACGCGCAGTCTGGCGCAGAACCTGCTGCTCTTCGGCCGCGACGCGCCGCTC
CATGCCCAGGTCGACGCCGACTTCTTCTGGAACAGGCACATCCTGAGGCCATTTGTAGTCACGGGTCAGGACGCG
CTGGCTCTTCCCGTGATGCAGGGCTTCGTAGGCCAACGCGCCTTTGTTGTCGACACGGATCCGCCTCAGCTGGAC
GAGACGACGGCCGAGTCTCTCGAGATGCACAATCTTCCCTCTTCTGGTGAAGGCAGAGCCTCGTCGGAATTGCGC
CCGTCTGAACGAAGATACCTCGTTACCCTCGTCTCTCGTCGTTCCACCAAGAGAGCCGGTCTGCGCTACCTTCGT
CGAGGAGTCAACGAGGACGGCTTCACGGCCAACATGGTCGAGACGGAACAGCTTCTGTCGTCGGCATCTTGGGAT
CAGTCGCGGCCGACGAGCTCGTTTCTGCAGGTCAGGGGCAGTATTCCACTCTACTTTACGCAGTCGGCCTACTCT
CTCAAGCCGGTGCCCGTGATACAGCATTCGGTCGAGTCCAACCTCAAGGCCTGCAGGAAGCACTTTGAGAGGCTG
TCCAAGGCTTACGGTCTGCTGCAGGTCGTCAGCCTGGTCGAGAAGACGGGCATCGAGGAACCCATCGGTTCGCAG
TATCAGACGAGCGTCGACCGGCTCAACGAGGGGCTCCGACAACCGGACAAGATACCCTTTGAATGGTTCGACTTC
CATCAAGCCTGTCGCGGCATGAAGTTTGAAAACGTCAGCCAGCTGCTGCTGAGGCTCAAAGATCGACTCGAAGAG
CTCGGCACCACGACGCAGCGACAGGGTGAGCTGACGCAGAAGCAAAAGGGAGTCGTGCGGACGAACTGCATGGAC
TGTCTGGACCGGACCAACGTCTGCCAGAGCTCCTTCGCCAAGTACATGCTCGACCACGCGCTCAAGGAAGACGGG
GTGGATATGAGCGCTCAGCTGGACCAGGAGACGGCCTGGTTCAATACGCTGTGGGCGGACAACGGTGACGCCGTC
TCGAAGCAGTACGCCTCTACGGCCGCTATGAAAGGCGACTACACCAGGACGAGGAAGAGAGACTATCGCGGAGCG
CTCAATGACCTGGGGCTGTCACTGGCGCGCTTCTACAGCGGCATGGTCAACGACTACTTTGGCCAGGCGGCCATC
GATTTCCTACTGGGAAACGTCACCTCCAAGATCTTTGACGAGTTCGAGGCCGACATGATGACCAAGGACCCGGCC
GTGTCCATCTCCAACATGAGGCAACGGGCCGTCGAGCTCTGTCGCAAGAGGGTCGTGGCCGACGAGCGTGAGGAG
TTTCACGGAGGATGGGTTCTTCTCAGCCCCAACGCCGCCGACGTGGTCAAGTCCTGGTCTATGGACGAGGTCGTT
CTGCTCTTGACCGACGCTGCCGTCTATCTCTGTCGATTTGACTGGGATCTCGACAAGGTATCGTCCTTTGAGCGC
GTCCATCTCGCCAACGTGACGAGCATCAAGCAAGGTACGTACATCACATCGACCGTCTCGCCCGCCCACATGGAT
GAGGAGAGGAACGTGGGTTTCGTCATCGAGTATCAGCCTGGGAAGAGCAACATCCAGCGAACCAACACCCGAACG
CTGTCCAGCCGCAGCGAGTTCGGGCCCGGCAAGACAGACGTCCAGAATTGCGACGGCAGCTACCGGCAGACGGGC
TTCGGGAACCTGTTTTCGGCCAAGACCAAGTCGCGGTCCGCTCGCAGGCTGGCGCTCAAGGCTCCGTACGCCAAC
TCGTCGGCCTCGGCGCCCGAGAGCGTGCCGTGTCAGACGGAGAAGCAGCTGGTGACGGCGATATGCGCCGAGATT
GAGCGCCTGGCGCTGGAGCGTCAGTTCCGCAAAGAGGGTGATGGCGGCAAGAGCATCGTCGAGAAGGGGGATGTG
ATATCGCTCGAGGCGGCGAAGCGGAATACGGGACTGCTGGAACAGCTGGGTCACTCGATCAAGAAACTGGTCTGG
GCTTGA
Transcript >Ophun1|2695
ATGCCTGGGATCGCACGAAAGATTGTCGTCTGCGCGGCCATCGACGGCCTGATAGTCCAGCCGGTCTCGTCCAAG
GGCCAGCGGGCCTATCAGCCCGTTCGGGTCAAATACGACGACTCTTCCGTCTCGGCCGTGCCTCGAGATCAGATT
CCTGATAGGACCGAGCCGGAGGAGTCGTTCGAGGCCTTTGGCATCATCGGCCTCATCACCGTGTCGAAACTGAGC
TATCTCATCACCATCGTCCGCCGCCAGCAGGTGGCTCAGATCCGAGGCTGTCCCGTCTTCGTCGTCACAGACGTT
GCCGTCACTCCCTGCACGTCGCAGTCGGATGCCATCGAATCCATCCGTCAGACGGCGAAGCTGCTGCAGGCCCGT
TCCCCGGACACCCGAAGCGAGGCCGCCGAGAGCAGCGACGGAGACGCCGACGCGTCCGATCGAGTCCAAGACGAT
GATGCCGACAGCGAGATCGACGCTGCAAAGCCGGAAGCCGAGCGCAGCAGCGTCGCCGAGGACGTCATCCGTCGA
CGCGGGAGCTACGGGAGGTTCGCGCAGAGCTGGTTCAGCAACAGCGGATGGACCATGGATCAGCGTCGCAGCATG
GGCATGAGCATATCCTCGCCCGTCCCGGCTCCGGACTCGGAAGAGGCTCCGGCCGCCGCCGAAGACGTCCATGTG
TCATCACCCGTGTCGGCGCTGCTTCCCAAGCTCTTGCGCTTCGTCAAGGTCATCTTCGGCTCTTCGCGAAGCTTC
TACTTTTCGTACGACGTCGATGTGACGCGCAGTCTGGCGCAGAACCTGCTGCTCTTCGGCCGCGACGCGCCGCTC
CATGCCCAGGTCGACGCCGACTTCTTCTGGAACAGGCACATCCTGAGGCCATTTGTAGTCACGGGTCAGGACGCG
CTGGCTCTTCCCGTGATGCAGGGCTTCGTAGGCCAACGCGCCTTTGTTGTCGACACGGATCCGCCTCAGCTGGAC
GAGACGACGGCCGAGTCTCTCGAGATGCACAATCTTCCCTCTTCTGGTGAAGGCAGAGCCTCGTCGGAATTGCGC
CCGTCTGAACGAAGATACCTCGTTACCCTCGTCTCTCGTCGTTCCACCAAGAGAGCCGGTCTGCGCTACCTTCGT
CGAGGAGTCAACGAGGACGGCTTCACGGCCAACATGGTCGAGACGGAACAGCTTCTGTCGTCGGCATCTTGGGAT
CAGTCGCGGCCGACGAGCTCGTTTCTGCAGGTCAGGGGCAGTATTCCACTCTACTTTACGCAGTCGGCCTACTCT
CTCAAGCCGGTGCCCGTGATACAGCATTCGGTCGAGTCCAACCTCAAGGCCTGCAGGAAGCACTTTGAGAGGCTG
TCCAAGGCTTACGGTCTGCTGCAGGTCGTCAGCCTGGTCGAGAAGACGGGCATCGAGGAACCCATCGGTTCGCAG
TATCAGACGAGCGTCGACCGGCTCAACGAGGGGCTCCGACAACCGGACAAGATACCCTTTGAATGGTTCGACTTC
CATCAAGCCTGTCGCGGCATGAAGTTTGAAAACGTCAGCCAGCTGCTGCTGAGGCTCAAAGATCGACTCGAAGAG
CTCGGCACCACGACGCAGCGACAGGGTGAGCTGACGCAGAAGCAAAAGGGAGTCGTGCGGACGAACTGCATGGAC
TGTCTGGACCGGACCAACGTCTGCCAGAGCTCCTTCGCCAAGTACATGCTCGACCACGCGCTCAAGGAAGACGGG
GTGGATATGAGCGCTCAGCTGGACCAGGAGACGGCCTGGTTCAATACGCTGTGGGCGGACAACGGTGACGCCGTC
TCGAAGCAGTACGCCTCTACGGCCGCTATGAAAGGCGACTACACCAGGACGAGGAAGAGAGACTATCGCGGAGCG
CTCAATGACCTGGGGCTGTCACTGGCGCGCTTCTACAGCGGCATGGTCAACGACTACTTTGGCCAGGCGGCCATC
GATTTCCTACTGGGAAACGTCACCTCCAAGATCTTTGACGAGTTCGAGGCCGACATGATGACCAAGGACCCGGCC
GTGTCCATCTCCAACATGAGGCAACGGGCCGTCGAGCTCTGTCGCAAGAGGGTCGTGGCCGACGAGCGTGAGGAG
TTTCACGGAGGATGGGTTCTTCTCAGCCCCAACGCCGCCGACGTGGTCAAGTCCTGGTCTATGGACGAGGTCGTT
CTGCTCTTGACCGACGCTGCCGTCTATCTCTGTCGATTTGACTGGGATCTCGACAAGGTATCGTCCTTTGAGCGC
GTCCATCTCGCCAACGTGACGAGCATCAAGCAAGGTACGTACATCACATCGACCGTCTCGCCCGCCCACATGGAT
GAGGAGAGGAACGTGGGTTTCGTCATCGAGTATCAGCCTGGGAAGAGCAACATCCAGCGAACCAACACCCGAACG
CTGTCCAGCCGCAGCGAGTTCGGGCCCGGCAAGACAGACGTCCAGAATTGCGACGGCAGCTACCGGCAGACGGGC
TTCGGGAACCTGTTTTCGGCCAAGACCAAGTCGCGGTCCGCTCGCAGGCTGGCGCTCAAGGCTCCGTACGCCAAC
TCGTCGGCCTCGGCGCCCGAGAGCGTGCCGTGTCAGACGGAGAAGCAGCTGGTGACGGCGATATGCGCCGAGATT
GAGCGCCTGGCGCTGGAGCGTCAGTTCCGCAAAGAGGGTGATGGCGGCAAGAGCATCGTCGAGAAGGGGGATGTG
ATATCGCTCGAGGCGGCGAAGCGGAATACGGGACTGCTGGAACAGCTGGGTCACTCGATCAAGAAACTGGTCTGG
GCTTGA
Gene >Ophun1|2695
ATGCCTGGGATCGCACGAAAGATTGTCGTCTGCGCGGCCATCGACGGCCTGATAGTCCAGCCGGTCTCGTCCAAG
GGCCAGCGGGCCTATCAGCCCGTTCGGGTCAAATACGACGACTCTTCCGTCTCGGCCGTGCCTCGAGATCAGATT
CCTGATAGGACCGAGCCGGAGGAGTCGTTCGAGGCCTTTGGCATCATCGGTGGGCACGCGCGACTGTGTGTATGA
GCGCCATCGGACGGGACTAAGCTTTCTTCTCGTCCAGGCCTCATCACCGTGTCGAAACTGAGCTATCTCATCACC
ATCGTCCGCCGCCAGCAGGTGGCTCAGATCCGAGGCTGTCCCGTCTTCGTCGTCACAGACGTTGCCGTCACTCCC
TGCACGTCGCAGTCGGATGCCATCGAATCCATCCGTCAGACGGCGAAGCTGCTGCAGGCCCGTTCCCCGGACACC
CGAAGCGAGGCCGCCGAGAGCAGCGACGGAGACGCCGACGCGTCCGATCGAGTCCAAGACGATGATGCCGACAGC
GAGATCGACGCTGCAAAGCCGGAAGCCGAGCGCAGCAGCGTCGCCGAGGACGTCATCCGTCGACGCGGGAGCTAC
GGGAGGTTCGCGCAGAGCTGGTTCAGCAACAGCGGATGGACCATGGATCAGCGTCGCAGCATGGGCATGAGCATA
TCCTCGCCCGTCCCGGCTCCGGACTCGGAAGAGGCTCCGGCCGCCGCCGAAGACGTCCATGTGTCATCACCCGTG
TCGGCGCTGCTTCCCAAGCTCTTGCGCTTCGTCAAGGTCATCTTCGGCTCTTCGCGAAGCTTCTACTTTTCGTAC
GACGTCGATGTGACGCGCAGTCTGGCGCAGAACCTGCTGCTCTTCGGCCGCGACGCGCCGCTCCATGCCCAGGTC
GACGCCGACTTCTTCTGGAACAGGCACATCCTGAGGCCATTTGTAGTCACGGGTCAGGACGCGCTGGCTCTTCCC
GTGATGCAGGGCTTCGTAGGCCAACGCGCCTTTGTTGTCGACACGGATCCGCCTCAGCTGGACGAGACGACGGCC
GAGTCTCTCGAGATGCACAATCTTCCCTCTTCTGGTGAAGGCAGAGCCTCGTCGGAATTGCGCCCGTCTGAACGA
AGATACCTCGTTACCCTCGTCTCTCGTCGTTCCACCAAGAGAGCCGGTCTGCGCTACCTTCGTCGAGGAGTCAAC
GAGGACGGCTTCACGGCCAACATGGTCGAGACGGAACAGCTTCTGTCGTCGGCATCTTGGGATCAGTCGCGGCCG
ACGAGCTCGTTTCTGCAGGTCAGGGGCAGTATTCCACTCTACTTTACGCAGTCGGCCTACTCTCTCAAGCCGGTG
CCCGTGATACAGCATTCGGTCGAGTCCAACCTCAAGGCCTGCAGGAAGCACTTTGAGAGGCTGTCCAAGGCTTAC
GGTCTGCTGCAGGTCGTCAGCCTGGTCGAGAAGACGGGCATCGAGGAACCCATCGGTTCGCAGTATCAGACGAGC
GTCGACCGGCTCAACGAGGGGCTCCGACAACCGGACAAGATACCCTTTGAATGGTTCGACTTCCATCAAGCCTGT
CGCGGCATGAAGTTTGAAAACGTCAGCCAGCTGCTGCTGAGGCTCAAAGATCGACTCGAAGAGCTCGGCACCACG
ACGCAGCGACAGGGTGAGCTGACGCAGAAGCAAAAGGGAGTCGTGCGGACGAACTGCATGGACTGTCTGGACCGG
ACCAACGTCTGCCAGAGCTCCTTCGCCAAGTACATGCTCGACCACGCGCTCAAGGAAGACGGGGTGGATATGAGC
GCTCAGCTGGACCAGGAGACGGCCTGGTTCAATACGCTGTGGGCGGACAACGGTGACGCCGTCTCGAAGCAGTAC
GCCTCTACGGCCGCTATGAAAGGCGACTACACCAGGACGAGGAAGAGAGACTATCGCGGAGCGCTCAATGACCTG
GGGCTGTCACTGGCGCGCTTCTACAGCGGGTAGGTCCTGAGTTTCTCGTACAGAGCCTTGAGAGTCTGACGCGGC
GGCAGCATGGTCAACGACTACTTTGGCCAGGCGGCCATCGATTTCCTACTGGGAAACGTCACCTCCAAGATCTTT
GACGAGTTCGAGGCCGACATGATGACCAAGGACCCGGCCGTGTCCATCTCCAACATGAGGCAACGGGCCGTCGAG
CTCTGTCGCAAGAGGGTCGTGGCCGACGAGCGTGAGGAGTTTCACGGAGGATGGGTTCTTCTCAGCCCCAACGCC
GCCGACGTGGTCAAGTCCTGGTCTATGGACGAGGTCGTTCTGCTCTTGACCGACGCTGCCGTCTATCTCTGTCGA
TTTGACTGGGATCTCGACAAGGTATCGTCCTTTGAGCGCGTCCATCTCGCCAACGTGACGAGCATCAAGCAAGGT
ACGTACATCACATCGACCGTCTCGCCCGCCCACATGGATGAGGAGAGGAACGTGGGTTTCGTCATCGAGTATCAG
CCTGGGAAGAGCAACATCCAGCGAACCAACACCCGAACGCTGTCCAGCCGCAGCGAGTTCGGGCCCGGCAAGACA
GACGTCCAGAATTGCGACGGCAGCTACCGGCAGACGGGCTTCGGGAACCTGTTTTCGGCCAAGACCAAGTCGCGG
TCCGCTCGCAGGCTGGCGCTCAAGGCTCCGTACGCCAACTCGTCGGCCTCGGCGCCCGAGAGCGTGCCGTGTCAG
ACGGAGAAGCAGCTGGTGACGGCGATATGCGCCGAGATTGAGCGCCTGGCGCTGGAGCGTCAGTTCCGCAAAGAG
GGTGATGGCGGCAAGAGCATCGTCGAGAAGGGGGATGTGATATCGCTCGAGGCGGCGAAGCGGAATACGGGACTG
CTGGAACAGCTGGGTCACTCGATCAAGAAACTGGTCTGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail