Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2677
Gene name
LocationContig_24:465..1532
Strand+
Gene length (bp)1067
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04614 Pex19 Pex19 protein family 2.0E-73 72 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VCI5|PEX19_MOUSE Peroxisomal biogenesis factor 19 OS=Mus musculus GN=Pex19 PE=1 SV=1 58 282 3.0E-18
sp|Q9SRQ3|PE191_ARATH Peroxisome biogenesis protein 19-1 OS=Arabidopsis thaliana GN=PEX19-1 PE=1 SV=1 132 282 5.0E-18
sp|P40855|PEX19_HUMAN Peroxisomal biogenesis factor 19 OS=Homo sapiens GN=PEX19 PE=1 SV=1 28 282 2.0E-17
sp|Q5R7U2|PEX19_PONAB Peroxisomal biogenesis factor 19 OS=Pongo abelii GN=PEX19 PE=2 SV=1 28 282 5.0E-17
sp|Q9QYU1|PEX19_RAT Peroxisomal biogenesis factor 19 OS=Rattus norvegicus GN=Pex19 PE=1 SV=1 28 282 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VCI5|PEX19_MOUSE Peroxisomal biogenesis factor 19 OS=Mus musculus GN=Pex19 PE=1 SV=1 58 282 3.0E-18
sp|Q9SRQ3|PE191_ARATH Peroxisome biogenesis protein 19-1 OS=Arabidopsis thaliana GN=PEX19-1 PE=1 SV=1 132 282 5.0E-18
sp|P40855|PEX19_HUMAN Peroxisomal biogenesis factor 19 OS=Homo sapiens GN=PEX19 PE=1 SV=1 28 282 2.0E-17
sp|Q5R7U2|PEX19_PONAB Peroxisomal biogenesis factor 19 OS=Pongo abelii GN=PEX19 PE=2 SV=1 28 282 5.0E-17
sp|Q9QYU1|PEX19_RAT Peroxisomal biogenesis factor 19 OS=Rattus norvegicus GN=Pex19 PE=1 SV=1 28 282 1.0E-16
sp|Q3SZD1|PEX19_BOVIN Peroxisomal biogenesis factor 19 OS=Bos taurus GN=PEX19 PE=2 SV=1 58 282 1.0E-16
sp|Q60415|PEX19_CRIGR Peroxisomal biogenesis factor 19 OS=Cricetulus griseus GN=PEX19 PE=1 SV=1 58 282 2.0E-16
sp|Q94EI3|PE192_ARATH Peroxisome biogenesis protein 19-2 OS=Arabidopsis thaliana GN=PEX19-2 PE=1 SV=1 158 282 2.0E-16
sp|Q07418|PEX19_YEAST Peroxisomal membrane protein import receptor PEX19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX19 PE=1 SV=2 112 275 2.0E-12
sp|A6ZXR1|PEX19_YEAS7 Peroxisomal membrane protein import receptor PEX19 OS=Saccharomyces cerevisiae (strain YJM789) GN=PEX19 PE=3 SV=2 112 275 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005777 peroxisome Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0042579 microbody No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4271
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4642
Ophiocordyceps australis map64 (Brazil) OphauB2|7241
Ophiocordyceps camponoti-floridani Ophcf2|00714
Ophiocordyceps camponoti-rufipedis Ophun1|2677 (this protein)
Ophiocordyceps kimflemingae Ophio5|6197
Ophiocordyceps subramaniannii Hirsu2|8731

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2677
MESSPKKDPEAQGAASVDEVPDPDEDDLDDLDDMLGEFSAIKLDPSKAPAASTEPPPDPVPQSTQKPDEAISEDE
FARQLQAGMADLLGELEKSPEMQEQLEDMFKHIAAESSAGASSSAPSTADAGADASFQDTIRRTMERMQSSGDQA
TAAAASEGTDDFMSEMLKQLSSGDFNAEGSDEDLSKMLMGMMEQLTNKDILYEPMKELDEKFPDWFDKNRDKTPA
PDLKRYEEQQGLVREIVAKFEESSYSDSNPSDREYIVDRMQKMQASGTPPSDLVGDMASAQEAFNAADDQCNPQ*
Coding >Ophun1|2677
ATGGAATCTTCGCCGAAAAAAGACCCCGAGGCGCAAGGCGCTGCCTCCGTCGACGAGGTACCAGATCCCGATGAA
GACGACCTGGACGACCTGGACGATATGCTGGGCGAGTTCTCCGCCATCAAGCTGGATCCTAGCAAGGCGCCAGCA
GCCTCGACAGAACCGCCGCCAGACCCGGTCCCCCAATCTACACAGAAGCCAGACGAGGCAATATCCGAAGACGAG
TTTGCAAGGCAACTACAGGCCGGCATGGCCGATCTGCTCGGCGAGTTGGAGAAATCACCAGAGATGCAAGAGCAG
CTGGAGGACATGTTCAAGCATATAGCAGCCGAGTCCAGCGCGGGCGCCTCCAGTTCAGCCCCGTCAACGGCCGAC
GCCGGGGCCGACGCCTCGTTCCAAGACACCATCCGCCGCACCATGGAGCGCATGCAGTCCTCCGGAGACCAGGCA
ACGGCGGCGGCCGCTTCGGAAGGCACCGACGATTTCATGTCCGAGATGCTCAAGCAGCTGTCGTCGGGCGACTTC
AACGCCGAGGGCAGCGACGAGGATCTGTCCAAGATGCTGATGGGCATGATGGAGCAGCTGACCAACAAGGACATA
CTATACGAGCCGATGAAGGAGCTCGACGAAAAGTTTCCCGACTGGTTCGACAAGAATAGAGATAAGACGCCGGCG
CCCGATTTGAAGCGGTACGAAGAGCAACAAGGACTCGTAAGGGAGATTGTCGCCAAGTTTGAGGAGAGCAGCTAC
TCGGATAGCAACCCTTCTGACCGGGAGTACATCGTCGACAGAATGCAAAAGATGCAGGCGTCCGGGACGCCGCCA
TCAGACCTCGTCGGAGACATGGCGTCGGCGCAGGAAGCCTTCAATGCCGCAGATGATCAGTGCAATCCCCAATGA
Transcript >Ophun1|2677
ATGGAATCTTCGCCGAAAAAAGACCCCGAGGCGCAAGGCGCTGCCTCCGTCGACGAGGTACCAGATCCCGATGAA
GACGACCTGGACGACCTGGACGATATGCTGGGCGAGTTCTCCGCCATCAAGCTGGATCCTAGCAAGGCGCCAGCA
GCCTCGACAGAACCGCCGCCAGACCCGGTCCCCCAATCTACACAGAAGCCAGACGAGGCAATATCCGAAGACGAG
TTTGCAAGGCAACTACAGGCCGGCATGGCCGATCTGCTCGGCGAGTTGGAGAAATCACCAGAGATGCAAGAGCAG
CTGGAGGACATGTTCAAGCATATAGCAGCCGAGTCCAGCGCGGGCGCCTCCAGTTCAGCCCCGTCAACGGCCGAC
GCCGGGGCCGACGCCTCGTTCCAAGACACCATCCGCCGCACCATGGAGCGCATGCAGTCCTCCGGAGACCAGGCA
ACGGCGGCGGCCGCTTCGGAAGGCACCGACGATTTCATGTCCGAGATGCTCAAGCAGCTGTCGTCGGGCGACTTC
AACGCCGAGGGCAGCGACGAGGATCTGTCCAAGATGCTGATGGGCATGATGGAGCAGCTGACCAACAAGGACATA
CTATACGAGCCGATGAAGGAGCTCGACGAAAAGTTTCCCGACTGGTTCGACAAGAATAGAGATAAGACGCCGGCG
CCCGATTTGAAGCGGTACGAAGAGCAACAAGGACTCGTAAGGGAGATTGTCGCCAAGTTTGAGGAGAGCAGCTAC
TCGGATAGCAACCCTTCTGACCGGGAGTACATCGTCGACAGAATGCAAAAGATGCAGGCGTCCGGGACGCCGCCA
TCAGACCTCGTCGGAGACATGGCGTCGGCGCAGGAAGCCTTCAATGCCGCAGATGATCAGTGCAATCCCCAATGA
Gene >Ophun1|2677
ATGGAATCTTCGCCGAAAAAAGACCCCGAGGCGCAAGGCGCTGCCTCCGTCGACGAGGTACCAGATCCCGATGAA
GACGACCTGGACGACCTGGACGGTGACGATGACCGGCAATCCCGAATATCTTTCGATCGCCTACTGACTGTTTCT
CTTAGATATGCTGGGCGAGTTCTCCGCCATCAAGCTGGATCCTAGCAAGGCGCCAGCAGCCTCGACAGAACCGCC
GCCAGACCCGGTCCCCCAATCTACACAGAAGCCAGACGAGGCAATATCCGAAGACGAGTTTGCAAGGCAACTACA
GGCCGGCATGGCCGATCTGCTCGGCGAGTTGGAGAAATCAGTGAGCAAAAGTGTACCGTTTACCCAACACCGCCC
CTAACAAGGCCGCAACTAGCCAGAGATGCAAGAGCAGCTGGAGGACATGTTCAAGCATATAGCAGCCGAGTCCAG
CGCGGGCGCCTCCAGTTCAGCCCCGTCAACGGCCGACGCCGGGGCCGACGCCTCGTTCCAAGACACCATCCGCCG
CACCATGGAGCGCATGCAGTCCTCCGGAGACCAGGCAACGGCGGCGGCCGCTTCGGAAGGCACCGACGATTTCAT
GTCCGAGATGCTCAAGCAGCTGTCGTCGGGCGACTTCAACGCCGAGGGCAGCGACGAGGATCTGTCCAAGATGCT
GATGGGCATGATGGAGCAGCTGACCAACAAGGACATACTATACGAGCCGATGAAGGAGCTCGACGAAAAGTTTCC
CGACTGGTTCGACAAGAATAGAGATAAGACGCCGGCGCCCGATTTGAAGCGGTACGAAGAGCAACAAGGACTCGT
AAGGGAGATTGTCGCCAAGTTTGAGGAGAGCAGCTACTCGGATAGCAACCCTTCTGACCGGGAGTACATCGTCGA
CAGAATGCAAAAGGTAATCGATGACTGCTTAGCACCGCTGGGAAGCTTCCTCGCTGACAGCAACGCAGATGCAGG
CGTCCGGGACGCCGCCATCAGACCTCGTCGGAGACATGGCGTCGGCGCAGGAAGCCTTCAATGCCGCAGATGATC
AGTGCAATCCCCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail