Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2676
Gene name
LocationContig_239:23526..25446
Strand-
Gene length (bp)1920
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00463 ICL Isocitrate lyase family 4.0E-280 18 540
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 3.1E-11 161 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 11 540 0.0E+00
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 16 540 0.0E+00
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 3 540 0.0E+00
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 3 540 0.0E+00
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 11 541 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 11 540 0.0E+00
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 16 540 0.0E+00
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 3 540 0.0E+00
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 3 540 0.0E+00
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 11 541 0.0E+00
sp|Q8NJ72|ACEA_KLULA Isocitrate lyase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ICL1 PE=2 SV=1 1 540 0.0E+00
sp|P25248|ACEA_BRANA Isocitrate lyase OS=Brassica napus PE=2 SV=1 11 540 0.0E+00
sp|P93110|ACEA_CUCMA Isocitrate lyase OS=Cucurbita maxima PE=2 SV=1 11 540 0.0E+00
sp|P49296|ACEA_CUCSA Isocitrate lyase OS=Cucumis sativus PE=3 SV=1 11 540 0.0E+00
sp|Q9SE26|ACEA_DENCR Isocitrate lyase OS=Dendrobium crumenatum GN=ICL PE=2 SV=1 11 540 0.0E+00
sp|P45456|ACEA1_SOYBN Isocitrate lyase 1 (Fragment) OS=Glycine max GN=ICL1 PE=2 SV=1 17 540 0.0E+00
sp|P45457|ACEA2_SOYBN Isocitrate lyase 2 (Fragment) OS=Glycine max GN=ICL2 PE=2 SV=1 17 540 0.0E+00
sp|P17069|ACEA_GOSHI Isocitrate lyase OS=Gossypium hirsutum PE=2 SV=1 11 540 0.0E+00
sp|P15479|ACEA_RICCO Isocitrate lyase OS=Ricinus communis PE=2 SV=1 11 540 0.0E+00
sp|Q6Z6M4|ACEA_ORYSJ Isocitrate lyase OS=Oryza sativa subsp. japonica GN=ICL PE=1 SV=1 11 540 0.0E+00
sp|P49297|ACEA_SOLLC Isocitrate lyase OS=Solanum lycopersicum PE=2 SV=1 11 540 0.0E+00
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 1 541 0.0E+00
sp|P28298|ACEA_EMENI Isocitrate lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuD PE=1 SV=3 11 540 0.0E+00
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 1 541 0.0E+00
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 1 540 0.0E+00
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 1 541 0.0E+00
sp|Q9C124|ACEA_PICPA Isocitrate lyase OS=Komagataella pastoris GN=ICL1 PE=3 SV=1 4 540 0.0E+00
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 11 540 0.0E+00
sp|Q6T267|ACEA_ASPFU Isocitrate lyase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=icl1 PE=3 SV=2 11 540 0.0E+00
sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase OS=Leptosphaeria maculans GN=ICL1 PE=2 SV=1 10 540 0.0E+00
sp|Q96WZ5|ACEA_TALMA Isocitrate lyase OS=Talaromyces marneffei GN=icl1 PE=3 SV=1 1 540 0.0E+00
sp|Q6BRY4|ACEA_DEBHA Isocitrate lyase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ICL1 PE=3 SV=1 1 540 0.0E+00
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 9 540 0.0E+00
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 9 540 0.0E+00
sp|P41555|ACEA_YARLI Isocitrate lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ICL1 PE=3 SV=3 10 540 0.0E+00
sp|P20014|ACEA_CANTR Isocitrate lyase OS=Candida tropicalis GN=ICL1 PE=3 SV=1 1 540 0.0E+00
sp|Q9P8Q7|ACEA_CANAX Isocitrate lyase OS=Candida albicans GN=ICL1 PE=3 SV=1 1 540 0.0E+00
sp|Q9HFN2|ACEA_CYBJA Isocitrate lyase OS=Cyberlindnera jadinii GN=ICL1 PE=3 SV=1 1 540 0.0E+00
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 8 540 9.0E-170
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 11 540 7.0E-166
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 1 537 8.0E-156
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 2 540 5.0E-141
sp|Q9P6J1|ACEB_SCHPO Mitochondrial 2-methylisocitrate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=icl2 PE=3 SV=1 5 517 6.0E-94
sp|P46831|ACEA_MYCLE Isocitrate lyase OS=Mycobacterium leprae (strain TN) GN=aceA PE=3 SV=2 15 490 7.0E-92
sp|Q8VJU4|ACEA2_MYCTO Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl2 PE=1 SV=2 15 539 2.0E-90
sp|H8F3R6|ACEA2_MYCTE Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=aceAb PE=1 SV=1 15 539 2.0E-90
sp|Q7TZA8|ACEA2_MYCBO Isocitrate lyase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aceA PE=3 SV=1 15 539 2.0E-90
sp|O07718|ACEAA_MYCTU Putative isocitrate lyase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAa PE=1 SV=1 15 324 5.0E-57
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 18 270 4.0E-46
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 24 274 2.0E-45
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 18 270 2.0E-44
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 18 270 2.0E-44
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 340 540 8.0E-41
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 23 270 2.0E-39
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 23 270 9.0E-38
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 367 540 1.0E-37
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 23 271 2.0E-37
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 23 270 5.0E-37
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 23 270 5.0E-37
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 23 270 5.0E-37
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 23 270 5.0E-37
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 367 540 2.0E-36
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 367 540 2.0E-36
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 29 268 3.0E-36
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 340 541 3.0E-35
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 340 541 3.0E-35
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 340 541 3.0E-35
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 340 541 3.0E-35
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 340 541 6.0E-35
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 367 541 2.0E-34
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 335 541 5.0E-34
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 367 541 6.0E-32
sp|O07717|ACEAB_MYCTU Putative isocitrate lyase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAb PE=3 SV=1 331 539 4.0E-30
sp|Q9I0K4|ACEA_PSEAE Isocitrate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2634 PE=1 SV=1 381 541 3.0E-15
sp|O50078|ACEA_HYPME Isocitrate lyase OS=Hyphomicrobium methylovorum GN=aceA PE=1 SV=1 72 255 7.0E-14
sp|P20699|ACEA_HELAN Isocitrate lyase (Fragment) OS=Helianthus annuus PE=2 SV=1 483 538 1.0E-13
sp|Q9I0K4|ACEA_PSEAE Isocitrate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2634 PE=1 SV=1 80 255 2.0E-12
sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=2 SV=2 148 254 2.0E-11
sp|P54528|PRPB_BACSU 2-methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 168 277 1.0E-10
sp|D4GTL3|ACEA_HALVD Isocitrate lyase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aceA PE=1 SV=1 168 250 4.0E-09
sp|Q9Z9T7|PRPB_BACHD 2-methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 168 288 8.0E-09
sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 168 250 2.0E-08
sp|P77541|PRPB_ECOLI 2-methylisocitrate lyase OS=Escherichia coli (strain K12) GN=prpB PE=1 SV=3 168 268 2.0E-08
sp|Q8EJW1|PRPB_SHEON 2-methylisocitrate lyase OS=Shewanella oneidensis (strain MR-1) GN=prpB PE=3 SV=1 168 268 2.0E-08
sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 168 250 3.0E-08
sp|Q937P0|PRPB_CUPNE 2-methylisocitrate lyase OS=Cupriavidus necator GN=prpB PE=1 SV=1 168 252 4.0E-08
sp|Q56062|PRPB_SALTY 2-methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpB PE=1 SV=3 168 268 4.0E-08
sp|Q9YFM7|PRPB_AERPE 2-methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 168 250 3.0E-07
sp|Q9KSC2|PRPB_VIBCH 2-methylisocitrate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prpB PE=3 SV=1 168 261 4.0E-07
sp|D4GTL3|ACEA_HALVD Isocitrate lyase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aceA PE=1 SV=1 370 469 1.0E-06
sp|Q05957|PDP_DIACA Petal death protein OS=Dianthus caryophyllus GN=PDP PE=1 SV=1 183 252 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004451 isocitrate lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016833 oxo-acid-lyase activity No
GO:0016830 carbon-carbon lyase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup124
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1526
Ophiocordyceps australis 1348a (Ghana) OphauG2|919
Ophiocordyceps australis map64 (Brazil) OphauB2|2441
Ophiocordyceps australis map64 (Brazil) OphauB2|2794
Ophiocordyceps camponoti-floridani Ophcf2|00970
Ophiocordyceps camponoti-floridani Ophcf2|02425
Ophiocordyceps camponoti-rufipedis Ophun1|2676 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6771
Ophiocordyceps kimflemingae Ophio5|2021
Ophiocordyceps kimflemingae Ophio5|2810
Ophiocordyceps subramaniannii Hirsu2|1003
Ophiocordyceps subramaniannii Hirsu2|6391
Ophiocordyceps subramaniannii Hirsu2|7486

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2676
MLSTTTDGAAEDAAFAAEVARVESWWREPRWRFTRRPFTAEQIVNKRGSLAVAYASDVQAKKLWGILEGRFETGD
ASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASSSDEPGPDLADYPYTTVPNKVSHLFTAQLFHDRKQRQERL
STPRAQRSALPFIDYLRPIIADADTGHGGLTAVMKLTKLFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHI
NRLVAIRAQADIMGSNLIAIARTDAEAATLITTTIDARDHAFILGSTNPNLPPLNDLMTSAEQSGKTGSDLERIE
QDWLTAAKLMRFDDAVIAACASRPDGSRRADQYRSRCAGRSNAEARALAAEVLGDGAAVFFDWDAPRTREGYYRL
QGGCDCAINRAVAYGPYADAVWMESKLPDFAQAKEFADGVHAVLPHQKLAYNLSPSFNWKSAMPPDQQETYIRRL
AALGYCWQFITLAGLHTTALISDRFARAFSQHGMRAYGELVQEPEMELGVDVVKHQKWSGANYVDELQKMVTGGV
SSTSAMGKGVTEDQFH*
Coding >Ophun1|2676
ATGCTCAGCACGACCACGGACGGCGCCGCCGAAGACGCAGCCTTCGCGGCAGAAGTGGCCCGCGTGGAGAGCTGG
TGGCGCGAGCCGCGGTGGAGGTTCACGCGTCGGCCGTTCACCGCCGAGCAGATTGTCAACAAGCGCGGGTCGTTG
GCTGTTGCGTATGCGAGTGATGTGCAGGCGAAGAAGCTGTGGGGGATTCTCGAGGGGCGGTTTGAGACTGGGGAT
GCCAGTTATACGTATGGATGCCTTGAACCGACCATGGTGACGCAGATGGCCAAATATCTCGACACCGTTTACGTC
TCCGGCTGGCAGTCCTCCTCCACAGCCTCTTCCTCGGACGAACCAGGCCCAGATCTAGCAGATTACCCCTACACA
ACCGTCCCCAACAAAGTCTCCCACCTCTTCACCGCCCAACTCTTCCACGACCGCAAACAACGCCAAGAGCGCCTC
TCCACGCCCCGAGCACAGCGCTCCGCCCTCCCCTTCATCGACTACCTGCGTCCCATCATCGCCGACGCCGATACC
GGTCATGGCGGCCTCACTGCCGTCATGAAGCTCACCAAGCTGTTCGTCGAGAAGGGCGCCGCCGGGATTCACATC
GAGGATCAGGCGCCGGGGACGAAGAAGTGTGGGCATATGGCTGGCAAGGTCCTCGTTCCCATCAGCGAGCATATA
AACAGACTGGTCGCCATCCGCGCGCAAGCCGACATCATGGGCTCCAACCTCATAGCCATAGCCCGCACCGACGCC
GAAGCCGCAACCCTGATAACAACCACCATCGACGCCCGCGACCACGCCTTCATCCTCGGCAGCACAAACCCCAAC
CTCCCCCCCCTAAACGACCTCATGACCTCGGCCGAACAATCCGGAAAGACAGGCTCCGACCTCGAACGCATAGAG
CAGGACTGGCTCACGGCCGCCAAGCTGATGCGCTTCGACGACGCCGTCATCGCCGCCTGCGCCTCCCGCCCGGAT
GGATCCCGTCGCGCCGATCAGTATCGCTCTCGCTGTGCTGGACGCTCCAACGCCGAGGCTCGTGCTCTTGCCGCT
GAGGTTCTGGGCGATGGCGCGGCCGTCTTCTTTGACTGGGATGCGCCTCGTACTAGGGAGGGTTACTATCGTCTT
CAGGGGGGGTGTGACTGCGCCATCAACCGTGCCGTCGCTTATGGGCCTTATGCAGACGCTGTCTGGATGGAGAGC
AAGTTGCCCGACTTTGCCCAGGCCAAGGAGTTTGCCGACGGTGTTCACGCGGTGCTTCCCCATCAAAAACTGGCC
TATAACCTCTCCCCCTCGTTCAACTGGAAGTCGGCCATGCCCCCTGACCAGCAAGAGACTTACATCCGCCGTCTC
GCCGCCCTCGGCTACTGCTGGCAGTTCATCACCCTCGCCGGCCTTCACACCACCGCCCTCATCAGTGACCGCTTC
GCCCGGGCCTTTAGCCAGCACGGCATGCGTGCCTACGGTGAGCTCGTCCAGGAGCCCGAGATGGAGCTCGGCGTC
GACGTCGTCAAGCACCAGAAATGGAGCGGCGCAAACTACGTCGACGAGCTGCAAAAGATGGTCACCGGAGGCGTC
AGCTCTACCTCGGCCATGGGCAAGGGCGTTACCGAGGACCAGTTCCACTGA
Transcript >Ophun1|2676
ATGCTCAGCACGACCACGGACGGCGCCGCCGAAGACGCAGCCTTCGCGGCAGAAGTGGCCCGCGTGGAGAGCTGG
TGGCGCGAGCCGCGGTGGAGGTTCACGCGTCGGCCGTTCACCGCCGAGCAGATTGTCAACAAGCGCGGGTCGTTG
GCTGTTGCGTATGCGAGTGATGTGCAGGCGAAGAAGCTGTGGGGGATTCTCGAGGGGCGGTTTGAGACTGGGGAT
GCCAGTTATACGTATGGATGCCTTGAACCGACCATGGTGACGCAGATGGCCAAATATCTCGACACCGTTTACGTC
TCCGGCTGGCAGTCCTCCTCCACAGCCTCTTCCTCGGACGAACCAGGCCCAGATCTAGCAGATTACCCCTACACA
ACCGTCCCCAACAAAGTCTCCCACCTCTTCACCGCCCAACTCTTCCACGACCGCAAACAACGCCAAGAGCGCCTC
TCCACGCCCCGAGCACAGCGCTCCGCCCTCCCCTTCATCGACTACCTGCGTCCCATCATCGCCGACGCCGATACC
GGTCATGGCGGCCTCACTGCCGTCATGAAGCTCACCAAGCTGTTCGTCGAGAAGGGCGCCGCCGGGATTCACATC
GAGGATCAGGCGCCGGGGACGAAGAAGTGTGGGCATATGGCTGGCAAGGTCCTCGTTCCCATCAGCGAGCATATA
AACAGACTGGTCGCCATCCGCGCGCAAGCCGACATCATGGGCTCCAACCTCATAGCCATAGCCCGCACCGACGCC
GAAGCCGCAACCCTGATAACAACCACCATCGACGCCCGCGACCACGCCTTCATCCTCGGCAGCACAAACCCCAAC
CTCCCCCCCCTAAACGACCTCATGACCTCGGCCGAACAATCCGGAAAGACAGGCTCCGACCTCGAACGCATAGAG
CAGGACTGGCTCACGGCCGCCAAGCTGATGCGCTTCGACGACGCCGTCATCGCCGCCTGCGCCTCCCGCCCGGAT
GGATCCCGTCGCGCCGATCAGTATCGCTCTCGCTGTGCTGGACGCTCCAACGCCGAGGCTCGTGCTCTTGCCGCT
GAGGTTCTGGGCGATGGCGCGGCCGTCTTCTTTGACTGGGATGCGCCTCGTACTAGGGAGGGTTACTATCGTCTT
CAGGGGGGGTGTGACTGCGCCATCAACCGTGCCGTCGCTTATGGGCCTTATGCAGACGCTGTCTGGATGGAGAGC
AAGTTGCCCGACTTTGCCCAGGCCAAGGAGTTTGCCGACGGTGTTCACGCGGTGCTTCCCCATCAAAAACTGGCC
TATAACCTCTCCCCCTCGTTCAACTGGAAGTCGGCCATGCCCCCTGACCAGCAAGAGACTTACATCCGCCGTCTC
GCCGCCCTCGGCTACTGCTGGCAGTTCATCACCCTCGCCGGCCTTCACACCACCGCCCTCATCAGTGACCGCTTC
GCCCGGGCCTTTAGCCAGCACGGCATGCGTGCCTACGGTGAGCTCGTCCAGGAGCCCGAGATGGAGCTCGGCGTC
GACGTCGTCAAGCACCAGAAATGGAGCGGCGCAAACTACGTCGACGAGCTGCAAAAGATGGTCACCGGAGGCGTC
AGCTCTACCTCGGCCATGGGCAAGGGCGTTACCGAGGACCAGTTCCACTGA
Gene >Ophun1|2676
ATGCTCAGCACGACCACGGACGGCGCCGCCGAAGACGCAGCCTTCGCGGCAGAAGTGGCCCGCGTGGAGAGCTGG
TGGCGCGAGCCGCGGTGGAGGTTCACGCGTCGGCCGTTCACCGCCGAGCAGATTGTCAACAAGCGCGGGTCGTTG
GCTGTTGCGTATGCGAGTGATGTGCAGGCGAAGAAGCTGTGGGGGATTCTCGAGGGGCGGTTTGAGGTTCGTTGT
TGTTGTTGTTGTTGTCTTCTGCCTTGTGTTGTTGAGGGTGAGGGTTGCTGACGGGTTTGACTTGCTTAGACTGGG
GATGCCAGTTATACGTATGGATGCCTTGAACCGACCATGGTGACGCAGATGGCCAAATATCTCGACACCGTTTAC
GTCTCCGGCTGGCAGTCCTCCTCCACAGCCTCTTCCTCGGACGAACCAGGCCCAGATCTAGCAGATTACCCCTAC
GTACGTCCTCACCACTCCCCCGTCACCCAATCCCCCCAACAAGACCACAATCTCTAACAAGACCACAACCCACAG
ACAACCGTCCCCAACAAAGTCTCCCACCTCTTCACCGCCCAACTCTTCCACGACCGCAAACAACGCCAAGAGCGC
CTCTCCACGCCCCGAGCACAGCGCTCCGCCCTCCCCTTCATCGACTACCTGCGTCCCATCATCGCCGACGCCGAT
ACCGGTCATGGCGGCCTCACTGCCGTCATGAAGCTCACCAAGCTGTTCGTCGAGAAGGGCGCCGCCGGGATTCAC
ATCGAGGATCAGGCGCCGGGGACGAAGAAGTGTGGGCATATGGCTGGCAAGGTCCTCGTTCCCATCAGCGAGCAT
ATAAACAGACTGGTCGCCATCCGCGCGCAAGCCGACATCATGGGTGAGAGACTGTCTTCCTCTACAACATCATCT
ACAACAACGACTAACAACCAAAACCAAAAGGCTCCAACCTCATAGCCATAGCCCGCACCGACGCCGAAGCCGCAA
CCCTGATAACAACCACCATCGACGCCCGCGACCACGCCTTCATCCTCGGCAGCACAAACCCCAACCTCCCCCCCC
TAAACGACCTCATGACCTCGGCCGAACAATCCGGAAAGACAGGCTCCGACCTCGAACGCATAGAGCAGGACTGGC
TCACGGCCGCCAAGCTGATGCGCTTCGACGACGCCGTCATCGCCGCCTGCGCCTCCCGCCCGGATGGATCCCGTC
GCGCCGATCAGTATCGCTCTCGCTGTGCTGGACGCTCCAACGCCGAGGCTCGTGCTCTTGCCGCTGAGGTTCTGG
GCGATGGCGCGGCCGTCTTCTTTGACTGGGATGCGCCTCGTACTAGGGAGGGTTACTATCGTCTTCAGGGGGGGT
GTGACTGCGCCATCAACCGTGCCGTCGCTTATGGGCCTTATGCAGACGCTGTCTGGATGGAGAGCAAGTTGCCCG
ACTTTGCCCAGGCCAAGGAGTTTGCCGACGGTGTTCACGCGGTGCTTCCCCATCAAAAGTCCGTTCTCCATCCGT
GTCTCTCTCTTCTCTTCGCTTCTCAACTCTTCTCAACTCTTGTCAACTAACCGCCTGCACAGACTGGCCTATAAC
CTCTCCCCCTCGTTCAACTGGAAGTCGGCCATGCCCCCTGACCAGCAAGAGACTTACATCCGCCGTCTCGCCGCC
CTCGGCTACTGCTGGCAGTTCATCACCCTCGCCGGCCTTCACACCACCGCCCTCATCAGTGACCGCTTCGCCCGG
GCCTTTAGCCAGCACGGCATGCGTGCCTACGGTGAGCTCGTCCAGGAGCCCGAGATGGAGCTCGGCGTCGACGTC
GTCAAGCACCAGAAATGGAGCGGCGCAAACTACGTCGACGAGCTGCAAAAGATGGTCACCGGAGGCGTCAGCTCT
ACCTCGGCCATGGGCAAGGGCGTTACCGAGGACCAGTTCCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail