Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2672
Gene name
LocationContig_239:13226..16488
Strand+
Gene length (bp)3262
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 2.7E-26 670 813

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 632 968 9.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 173 195 22
3 202 220 18
4 235 257 22
5 652 671 19
6 731 750 19
7 757 776 19
8 796 818 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2672
MSSNASVPWPPVRPSRRMRMRNGTFVIPSTGERSKRQVTLRASAGDGPWGYGSSSSNDTADGSPAADEGRVRATV
LALWRWLGSDEGHQVLKCTLAYLLGSLGTLWPLLSDFLGHRDGKHIVATITVYFHPARTVGSMLEAVFVAIIAVA
YAEAVSLLSMAAAIASRTSMGSVVPAHAIVLIVFVGGGLGFVGWVKQKMNHPLVNVASTLASIAIISVVTKEQSI
QDGYFSGGKIFQVFKMLLVGISFTVAVNLLVWRESARHVLRSSVASAMACMGDKLCIIAKSFLDGSEEEINSPTY
LTITSHYASVFEEMNRTIREAKLEYYFLGHEATYRLDRRLRKSVEATSQAIGGLRSALNTQMALLGEESQGAAPQ
TASSSSAMSSPAPPLASPRLVRVASSLTGETREPLSMIREMDDESRLAMLSRSDPSLDRSAFFRTPSDIVALFMA
LLGPSMKSLVFTLAEILRECPFDHESMKHVIINDRLRRSLGDALSLYNGARADAVRELYRSMELGRSSSEKVKAD
IEEVAAACGHFSFTLQAVAEELDSYLEILEELKQTSANTSRSWGWLKFWTSWKPFDRWRTASVDAERQPLLPKPS
IKKTALPKGMPTSMVKRRDAFSWNAAPQSSAFVRRMSQSMLTVLRFLDREDVAFGIKVGIGAVLWAMFAFIPSTR
PMYQHWRGEWGLLSYMIVVGMTTGASNTTSTSRFIGTMIGATCACLSWLACDDNPYLLALFGWLVAFWNFYLILV
KKKAPLGRISLLAYNVIVLYAYSLTLDVDDDDDDEGGTTPLIFNITYHRVVAVTLGILWGMIVCRLLWPISGRRK
FREGLSVLYLQLGLIWKRGSLKVLVDGQGSLNYMQEGEQMALQRYAFKLDSLREAAKSEFELRGPFPHEAYGRIM
RSTRHILDGFYAMRLITQRRFTLSRGERALLAATVDERARLCQRTSHVFQVLASSIMLEIPLTDAIPTIDGIKDL
LLGRIHLFRGQCMAAGLDGGAAVARERDFALLYAYTLVTAQVADELKKVRAEIEDLFGVLNQEDLLLEYT*
Coding >Ophun1|2672
ATGAGCTCCAACGCGTCCGTGCCCTGGCCGCCCGTCCGGCCTTCCAGACGGATGCGAATGCGAAACGGCACCTTC
GTCATCCCCAGCACCGGCGAACGCTCCAAACGCCAGGTCACGCTACGCGCCTCGGCCGGCGATGGACCCTGGGGC
TATGGCTCCTCGTCGTCCAACGATACGGCTGATGGCTCGCCCGCCGCCGACGAGGGTCGCGTAAGGGCTACCGTC
TTGGCCCTGTGGCGATGGCTGGGCTCGGATGAGGGCCACCAGGTGCTCAAATGCACTCTCGCCTATCTCCTCGGC
AGTCTGGGCACCCTGTGGCCGCTGCTGTCCGACTTCTTGGGCCATCGCGATGGCAAGCACATCGTGGCCACCATC
ACCGTCTACTTCCATCCAGCCCGCACCGTCGGCTCTATGCTCGAGGCTGTCTTCGTCGCCATCATCGCCGTCGCA
TATGCCGAAGCCGTCAGTCTCTTGTCCATGGCGGCGGCCATCGCCTCACGCACCAGTATGGGCTCCGTCGTTCCG
GCTCACGCCATCGTCCTCATCGTCTTTGTCGGCGGCGGCTTGGGCTTCGTCGGCTGGGTGAAGCAAAAGATGAAC
CATCCGCTCGTCAACGTCGCCTCCACCTTGGCCTCCATCGCCATCATATCTGTCGTCACCAAGGAGCAGTCTATC
CAGGATGGCTACTTTTCGGGAGGCAAAATCTTTCAGGTCTTCAAGATGCTCCTCGTCGGCATCTCCTTTACCGTC
GCCGTCAACCTCCTCGTCTGGCGCGAGTCGGCCAGGCACGTGTTGCGCAGCTCCGTCGCCTCCGCCATGGCGTGT
ATGGGCGACAAGCTGTGCATCATCGCAAAGAGCTTCTTGGACGGGTCGGAGGAGGAGATTAACTCTCCCACCTAC
CTCACCATCACCTCTCACTACGCTTCCGTCTTTGAGGAGATGAACCGGACGATTCGCGAGGCCAAGCTTGAATAC
TACTTTCTCGGTCATGAAGCCACTTACCGCCTGGACAGGCGCCTGCGCAAGTCCGTCGAGGCCACGTCTCAGGCC
ATTGGCGGCTTGCGGAGCGCCCTCAACACTCAGATGGCGCTTCTCGGGGAGGAGTCCCAAGGGGCTGCGCCGCAG
ACGGCATCTTCGTCGTCGGCAATGTCGTCGCCCGCTCCGCCCTTGGCCTCTCCCAGGCTGGTGCGAGTCGCGTCG
AGCCTCACTGGGGAGACGAGAGAACCCCTTTCCATGATCCGAGAGATGGACGACGAATCAAGGCTGGCGATGCTG
TCGCGATCCGACCCTTCACTTGATCGGTCGGCCTTTTTCCGAACGCCCTCGGACATCGTCGCCCTTTTCATGGCA
CTTCTGGGACCCTCGATGAAGTCCTTGGTCTTTACGCTGGCCGAGATTCTGCGCGAATGTCCTTTCGACCACGAG
TCGATGAAACACGTCATCATCAACGACCGGCTTAGAAGGAGCCTCGGTGACGCCCTCAGCCTCTACAATGGGGCC
AGGGCCGACGCCGTGCGAGAGCTGTACCGCAGCATGGAGCTGGGAAGATCCAGTTCCGAAAAGGTCAAGGCCGAC
ATCGAGGAGGTGGCAGCTGCCTGTGGGCACTTCTCCTTTACCCTCCAGGCCGTGGCCGAGGAGCTGGACTCGTAT
CTGGAGATTCTGGAAGAGCTGAAGCAGACGTCGGCCAACACCAGCCGGAGCTGGGGCTGGTTAAAGTTCTGGACC
TCCTGGAAGCCCTTTGACAGGTGGCGAACGGCTTCGGTCGATGCTGAGCGTCAGCCCCTGCTACCGAAGCCGTCG
ATCAAGAAGACGGCGCTTCCCAAGGGGATGCCGACGTCCATGGTCAAGCGGAGGGACGCCTTCAGCTGGAACGCG
GCACCGCAGTCGAGCGCCTTTGTGCGCCGAATGTCGCAGTCGATGCTGACGGTGCTTCGCTTCCTGGACCGCGAG
GACGTTGCCTTTGGCATCAAAGTCGGTATCGGAGCCGTCCTGTGGGCCATGTTCGCCTTTATACCGAGCACGCGG
CCCATGTATCAGCACTGGAGAGGCGAATGGGGTCTTCTGTCGTACATGATTGTCGTCGGCATGACGACGGGCGCC
TCCAACACGACGTCAACCTCGCGCTTCATCGGCACCATGATTGGGGCAACCTGTGCGTGTCTATCGTGGCTGGCC
TGCGACGACAACCCCTATCTCCTGGCTCTCTTCGGCTGGCTCGTCGCCTTCTGGAACTTTTACCTGATCCTGGTC
AAGAAGAAGGCTCCGCTGGGCCGCATATCGTTGCTGGCCTACAACGTCATCGTCCTCTACGCTTACAGCCTGACG
CTGGACGTTGACGACGATGACGATGACGAGGGAGGCACTACGCCCCTCATCTTCAACATTACCTACCATCGCGTC
GTGGCCGTTACTCTCGGCATCTTGTGGGGGATGATTGTCTGCAGGCTGCTGTGGCCCATATCTGGCCGGCGCAAG
TTCCGTGAAGGCCTCTCAGTGCTGTACCTTCAGCTGGGCCTCATCTGGAAGCGAGGGTCGCTCAAGGTCCTCGTC
GACGGCCAAGGGTCACTCAACTACATGCAAGAGGGTGAGCAGATGGCGCTGCAACGATACGCCTTCAAGCTCGAC
TCCCTCCGCGAGGCGGCCAAGTCTGAATTCGAGCTCCGGGGCCCGTTCCCGCACGAGGCCTATGGTCGGATCATG
AGATCGACGCGTCACATCCTCGACGGCTTCTACGCCATGCGCCTCATCACCCAGCGACGCTTCACCCTCTCCCGC
GGCGAACGGGCCCTTCTCGCCGCCACAGTCGACGAACGCGCTCGCCTCTGCCAGCGTACGAGCCACGTCTTCCAG
GTGCTGGCATCGAGCATCATGCTCGAGATCCCGCTCACCGACGCCATCCCCACCATCGACGGCATCAAGGACCTC
CTCCTCGGGCGCATCCATCTCTTCCGCGGCCAGTGCATGGCTGCTGGCCTTGACGGTGGCGCTGCCGTTGCGCGA
GAGCGGGACTTTGCCTTGCTGTATGCTTATACCCTCGTCACCGCACAGGTTGCCGACGAGCTCAAGAAGGTGCGG
GCTGAGATTGAAGATCTTTTTGGCGTTTTGAACCAGGAAGACTTGCTGCTTGAGTATACTTGA
Transcript >Ophun1|2672
ATGAGCTCCAACGCGTCCGTGCCCTGGCCGCCCGTCCGGCCTTCCAGACGGATGCGAATGCGAAACGGCACCTTC
GTCATCCCCAGCACCGGCGAACGCTCCAAACGCCAGGTCACGCTACGCGCCTCGGCCGGCGATGGACCCTGGGGC
TATGGCTCCTCGTCGTCCAACGATACGGCTGATGGCTCGCCCGCCGCCGACGAGGGTCGCGTAAGGGCTACCGTC
TTGGCCCTGTGGCGATGGCTGGGCTCGGATGAGGGCCACCAGGTGCTCAAATGCACTCTCGCCTATCTCCTCGGC
AGTCTGGGCACCCTGTGGCCGCTGCTGTCCGACTTCTTGGGCCATCGCGATGGCAAGCACATCGTGGCCACCATC
ACCGTCTACTTCCATCCAGCCCGCACCGTCGGCTCTATGCTCGAGGCTGTCTTCGTCGCCATCATCGCCGTCGCA
TATGCCGAAGCCGTCAGTCTCTTGTCCATGGCGGCGGCCATCGCCTCACGCACCAGTATGGGCTCCGTCGTTCCG
GCTCACGCCATCGTCCTCATCGTCTTTGTCGGCGGCGGCTTGGGCTTCGTCGGCTGGGTGAAGCAAAAGATGAAC
CATCCGCTCGTCAACGTCGCCTCCACCTTGGCCTCCATCGCCATCATATCTGTCGTCACCAAGGAGCAGTCTATC
CAGGATGGCTACTTTTCGGGAGGCAAAATCTTTCAGGTCTTCAAGATGCTCCTCGTCGGCATCTCCTTTACCGTC
GCCGTCAACCTCCTCGTCTGGCGCGAGTCGGCCAGGCACGTGTTGCGCAGCTCCGTCGCCTCCGCCATGGCGTGT
ATGGGCGACAAGCTGTGCATCATCGCAAAGAGCTTCTTGGACGGGTCGGAGGAGGAGATTAACTCTCCCACCTAC
CTCACCATCACCTCTCACTACGCTTCCGTCTTTGAGGAGATGAACCGGACGATTCGCGAGGCCAAGCTTGAATAC
TACTTTCTCGGTCATGAAGCCACTTACCGCCTGGACAGGCGCCTGCGCAAGTCCGTCGAGGCCACGTCTCAGGCC
ATTGGCGGCTTGCGGAGCGCCCTCAACACTCAGATGGCGCTTCTCGGGGAGGAGTCCCAAGGGGCTGCGCCGCAG
ACGGCATCTTCGTCGTCGGCAATGTCGTCGCCCGCTCCGCCCTTGGCCTCTCCCAGGCTGGTGCGAGTCGCGTCG
AGCCTCACTGGGGAGACGAGAGAACCCCTTTCCATGATCCGAGAGATGGACGACGAATCAAGGCTGGCGATGCTG
TCGCGATCCGACCCTTCACTTGATCGGTCGGCCTTTTTCCGAACGCCCTCGGACATCGTCGCCCTTTTCATGGCA
CTTCTGGGACCCTCGATGAAGTCCTTGGTCTTTACGCTGGCCGAGATTCTGCGCGAATGTCCTTTCGACCACGAG
TCGATGAAACACGTCATCATCAACGACCGGCTTAGAAGGAGCCTCGGTGACGCCCTCAGCCTCTACAATGGGGCC
AGGGCCGACGCCGTGCGAGAGCTGTACCGCAGCATGGAGCTGGGAAGATCCAGTTCCGAAAAGGTCAAGGCCGAC
ATCGAGGAGGTGGCAGCTGCCTGTGGGCACTTCTCCTTTACCCTCCAGGCCGTGGCCGAGGAGCTGGACTCGTAT
CTGGAGATTCTGGAAGAGCTGAAGCAGACGTCGGCCAACACCAGCCGGAGCTGGGGCTGGTTAAAGTTCTGGACC
TCCTGGAAGCCCTTTGACAGGTGGCGAACGGCTTCGGTCGATGCTGAGCGTCAGCCCCTGCTACCGAAGCCGTCG
ATCAAGAAGACGGCGCTTCCCAAGGGGATGCCGACGTCCATGGTCAAGCGGAGGGACGCCTTCAGCTGGAACGCG
GCACCGCAGTCGAGCGCCTTTGTGCGCCGAATGTCGCAGTCGATGCTGACGGTGCTTCGCTTCCTGGACCGCGAG
GACGTTGCCTTTGGCATCAAAGTCGGTATCGGAGCCGTCCTGTGGGCCATGTTCGCCTTTATACCGAGCACGCGG
CCCATGTATCAGCACTGGAGAGGCGAATGGGGTCTTCTGTCGTACATGATTGTCGTCGGCATGACGACGGGCGCC
TCCAACACGACGTCAACCTCGCGCTTCATCGGCACCATGATTGGGGCAACCTGTGCGTGTCTATCGTGGCTGGCC
TGCGACGACAACCCCTATCTCCTGGCTCTCTTCGGCTGGCTCGTCGCCTTCTGGAACTTTTACCTGATCCTGGTC
AAGAAGAAGGCTCCGCTGGGCCGCATATCGTTGCTGGCCTACAACGTCATCGTCCTCTACGCTTACAGCCTGACG
CTGGACGTTGACGACGATGACGATGACGAGGGAGGCACTACGCCCCTCATCTTCAACATTACCTACCATCGCGTC
GTGGCCGTTACTCTCGGCATCTTGTGGGGGATGATTGTCTGCAGGCTGCTGTGGCCCATATCTGGCCGGCGCAAG
TTCCGTGAAGGCCTCTCAGTGCTGTACCTTCAGCTGGGCCTCATCTGGAAGCGAGGGTCGCTCAAGGTCCTCGTC
GACGGCCAAGGGTCACTCAACTACATGCAAGAGGGTGAGCAGATGGCGCTGCAACGATACGCCTTCAAGCTCGAC
TCCCTCCGCGAGGCGGCCAAGTCTGAATTCGAGCTCCGGGGCCCGTTCCCGCACGAGGCCTATGGTCGGATCATG
AGATCGACGCGTCACATCCTCGACGGCTTCTACGCCATGCGCCTCATCACCCAGCGACGCTTCACCCTCTCCCGC
GGCGAACGGGCCCTTCTCGCCGCCACAGTCGACGAACGCGCTCGCCTCTGCCAGCGTACGAGCCACGTCTTCCAG
GTGCTGGCATCGAGCATCATGCTCGAGATCCCGCTCACCGACGCCATCCCCACCATCGACGGCATCAAGGACCTC
CTCCTCGGGCGCATCCATCTCTTCCGCGGCCAGTGCATGGCTGCTGGCCTTGACGGTGGCGCTGCCGTTGCGCGA
GAGCGGGACTTTGCCTTGCTGTATGCTTATACCCTCGTCACCGCACAGGTTGCCGACGAGCTCAAGAAGGTGCGG
GCTGAGATTGAAGATCTTTTTGGCGTTTTGAACCAGGAAGACTTGCTGCTTGAGTATACTTGA
Gene >Ophun1|2672
ATGAGCTCCAACGCGTCCGTGCCCTGGCCGCCCGTCCGGCCTTCCAGACGGATGGTAAGCCGACTCTTGTCCCTT
CCATCCTAGTGTCAGCCAGGGAGGCTGACGTCGGGCTGCAGCGAATGCGAAACGGCACCTTCGTCATCCCCAGCA
CCGGCGAACGCTCCAAACGCCAGGTCACGCTACGCGCCTCGGCCGGCGATGGACCCTGGGGCTATGGCTCCTCGT
CGTCCAACGATACGGCTGATGGCTCGCCCGCCGCCGACGAGGGTCGCGTAAGGGCTACCGTCTTGGCCCTGTGGC
GATGGCTGGGCTCGGATGAGGGCCACCAGGTGCTCAAATGCACTCTCGCCTATCTCCTCGGCAGTCTGGGCACCC
TGTGGCCGCTGCTGTCCGACTTCTTGGGCCATCGCGATGGCAAGCACATCGTGGCCACCATCACCGTCTACTTCC
ATCCAGCCCGCACCGTCGGCTCTATGCTCGAGGCTGTCTTCGTCGCCATCATCGCCGTCGCATATGCCGAAGCCG
TCAGTCTCTTGTCCATGGCGGCGGCCATCGCCTCACGCACCAGTATGGGCTCCGTCGTTCCGGCTCACGCCATCG
TCCTCATCGTCTTTGTCGGCGGCGGCTTGGGCTTCGTCGGCTGGGTGAAGCAAAAGATGAACCATCCGCTCGTCA
ACGTCGCCTCCACCTTGGCCTCCATCGCCATCATATCTGTCGTCACCAAGGAGCAGTCTATCCAGGATGGCTACT
TTTCGGGAGGCAAAATCTTTCAGGTCTTCAAGATGCTCCTCGTCGGCATCTCCTTTACCGTCGCCGTCAACCTCC
TCGTCTGGCGCGAGTCGGCCAGGCACGTGTTGCGCAGCTCCGTCGCCTCCGCCATGGCGTGTATGGGCGACAAGC
TGTGCATCATCGCAAAGAGCTTCTTGGACGGGTCGGAGGAGGAGATTAACTCTCCCACCTACCTCACCATCACCT
CTCACTACGCTTCCGTCTTTGAGGAGATGAACCGGACGATTCGCGAGGCCAAGCTTGAATACTACTTTCTCGGTC
ATGAAGCCACTTACCGCCTGGACAGGCGCCTGCGCAAGTCCGTCGAGGCCACGTCTCAGGCCATTGGCGGCTTGC
GGAGCGCCCTCAACACTCAGATGGCGCTTCTCGGGGAGGAGTCCCAAGGGGCTGCGCCGCAGACGGCATCTTCGT
CGTCGGCAATGTCGTCGCCCGCTCCGCCCTTGGCCTCTCCCAGGCTGGTGCGAGTCGCGTCGAGCCTCACTGGGG
AGACGAGAGAACCCCTTTCCATGATCCGAGAGATGGACGACGAATCAAGGCTGGCGATGCTGTCGCGATCCGACC
CTTCACTTGATCGGTCGGCCTTTTTCCGAACGCCCTCGGACATCGTCGCCCTTTTCATGGCACTTCTGGGACCCT
CGATGAAGTCCTTGGTCTTTACGCTGGCCGAGATTCTGCGCGAATGTCCTTTCGACCACGAGTCGATGAAACACG
TCATCATCAACGACCGGCTTAGAAGGAGCCTCGGTGACGCCCTCAGCCTCTACAATGGGGCCAGGGCCGACGCCG
TGCGAGAGCTGTACCGCAGCATGGAGCTGGGAAGATCCAGTTCCGAAAAGGTCAAGGCCGACATCGAGGAGGTGG
CAGCTGCCTGTGGGCACTTCTCCTTTACCCTCCAGGCCGTGGCCGAGGAGCTGGACTCGTATCTGGAGATTCTGG
AAGAGCTGAAGCAGACGTCGGCCAACACCAGCCGGAGCTGGGGCTGGTTAAAGTTCTGGACCTCCTGGAAGCCCT
TTGACAGGTGGCGAACGGCTTCGGTCGATGCTGAGCGTCAGCCCCTGCTACCGAAGCCGTCGATCAAGAAGACGG
CGCTTCCCAAGGGGATGCCGACGTCCATGGTCAAGCGGAGGGACGCCTTCAGCTGGAACGCGGCACCGCAGTCGA
GCGCCTTTGTGCGCCGAATGTCGCAGTCGATGCTGACGGTGCTTCGCTTCCTGGACCGCGAGGACGTTGCCTTTG
GCATCAAAGTCGGTATCGGAGCCGTCCTGTGGGCCATGTTCGCCTTTATACCGAGCACGCGGCCCATGTATCAGC
ACTGGAGAGGCGAATGGGGTCTTCTGTCGTACATGATTGTCGTCGGCATGACGACGGGCGCCTCCAACACGACGT
CAACCTCGCGCTTCATCGGCACCATGATTGGGGCAACCTGTGCGTGTCTATCGTGGCTGGCCTGCGACGACAACC
CCTATCTCCTGGCTCTCTTCGGCTGGCTCGTCGCCTTCTGGAACTTTTACCTGATCCTGGTCAAGAAGAAGGCTC
CGCTGGGCCGCATATCGTTGCTGGCCTACAACGTCATCGTCCTCTACGCTTACAGCCTGACGCTGGACGTTGACG
ACGATGACGATGACGAGGGAGGCACTACGCCCCTCATCTTCAACATTACCTACCATCGCGTCGTGGCCGTTACTC
TCGGCATCTTGTGGGGGATGATTGTCTGCAGGCTGCTGTGGCCCATATCTGGCCGGCGCAAGTTCCGTGAAGGCC
TCTCAGTGCTGTACCTTCAGCTGGGCCTCATCTGGAAGCGAGGGTCGCTCAAGGTCCTCGTCGACGGCCAAGGGT
CACTCAACTACATGCAAGAGGGTGAGCAGATGGCGCTGCAACGATACGGTGAGTCTCCTCACAACCCCCCCCTTT
TGTCCCTTTACCCCTGGCTGAACACTTCGACGTAGCCTTCAAGCTCGACTCCCTCCGCGAGGCGGCCAAGTCTGA
ATTCGAGCTCCGGGGCCCGTTCCCGCACGAGGCCTATGGTCGGATCATGAGATCGACGCGTCACATCCTCGACGG
CTTCTACGCCATGCGCCTCATCACCCAGCGACGCTTCACCCTCTCCCGCGGCGAACGGGCCCTTCTCGCCGCCAC
AGTCGACGAACGCGCTCGCCTCTGCCAGCGTACGAGCCACGTCTTCCAGGTGCTGGCATCGAGCATCATGCTCGA
GATCCCGCTCACCGACGCCATCCCCACCATCGACGGCATCAAGGACCTCCTCCTCGGGCGCATCCATCTCTTCCG
CGGCCAGTGCATGGCTGCTGGCCTTGACGGTGGCGCTGCCGTTGCGCGAGAGCGGGACTTTGCCTTGCTGTATGC
TTATACCCTCGTCACCGCACAGGTTGCCGACGAGCTCAAGAAGGTGCGGGCTGAGATTGAAGATCTTTTTGGCGT
TTTGAACCAGGAAGACTTGCTGCTTGAGTATACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail