Protein ID | Ophun1|2655 |
Gene name | |
Location | Contig_238:1658..2777 |
Strand | - |
Gene length (bp) | 1119 |
Transcript length (bp) | 1044 |
Coding sequence length (bp) | 1044 |
Protein length (aa) | 348 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 2.6E-09 | 145 | 238 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 8.6E-11 | 179 | 275 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 4.2E-09 | 250 | 319 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 3.2E-07 | 177 | 231 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 2.5E-07 | 248 | 297 |
PF00023 | Ank | Ankyrin repeat | 1.4E-02 | 16 | 43 |
PF00023 | Ank | Ankyrin repeat | 6.9E-03 | 178 | 205 |
PF00023 | Ank | Ankyrin repeat | 4.9E-03 | 278 | 303 |
PF13857 | Ank_5 | Ankyrin repeats (many copies) | 5.7E-07 | 264 | 319 |
PF13606 | Ank_3 | Ankyrin repeat | 1.7E-03 | 278 | 303 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 3 | 319 | 6.0E-23 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 3 | 319 | 2.0E-22 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 95 | 319 | 4.0E-22 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 95 | 319 | 1.0E-21 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 3 | 309 | 2.0E-21 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 3 | 319 | 6.0E-23 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 3 | 319 | 2.0E-22 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 95 | 319 | 4.0E-22 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 95 | 319 | 1.0E-21 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 3 | 309 | 2.0E-21 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 95 | 319 | 2.0E-21 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 3 | 347 | 4.0E-21 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 1 | 332 | 9.0E-21 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 1 | 332 | 2.0E-20 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 104 | 319 | 5.0E-20 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 325 | 6.0E-20 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 3 | 321 | 7.0E-20 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 1 | 303 | 8.0E-20 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 1 | 319 | 2.0E-19 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 1 | 325 | 2.0E-19 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 1 | 319 | 2.0E-19 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 1 | 319 | 2.0E-19 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 95 | 319 | 2.0E-19 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 1 | 321 | 4.0E-19 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 1 | 319 | 1.0E-18 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 1 | 321 | 2.0E-18 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 1 | 322 | 3.0E-18 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 103 | 302 | 4.0E-18 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 103 | 302 | 4.0E-18 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 104 | 320 | 6.0E-18 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 319 | 7.0E-18 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 1 | 319 | 7.0E-18 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 1 | 303 | 7.0E-18 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 1 | 322 | 1.0E-17 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 1 | 319 | 1.0E-17 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 153 | 303 | 1.0E-17 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 1 | 319 | 1.0E-17 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 103 | 302 | 1.0E-17 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 1 | 321 | 2.0E-17 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 1 | 319 | 2.0E-17 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 99 | 306 | 2.0E-17 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 4 | 303 | 2.0E-17 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 1 | 319 | 3.0E-17 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 153 | 303 | 3.0E-17 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 77 | 302 | 4.0E-17 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 1 | 321 | 4.0E-17 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 153 | 303 | 4.0E-17 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 153 | 303 | 4.0E-17 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 1 | 299 | 5.0E-17 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 1 | 321 | 5.0E-17 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 103 | 302 | 7.0E-17 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 1 | 319 | 1.0E-16 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 153 | 303 | 1.0E-16 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 304 | 2.0E-16 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 96 | 319 | 2.0E-16 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 1 | 316 | 3.0E-16 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 4 | 303 | 3.0E-16 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 1 | 322 | 4.0E-16 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 4 | 322 | 1.0E-15 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 4 | 322 | 1.0E-15 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 1 | 319 | 1.0E-15 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 96 | 319 | 1.0E-15 |
sp|Q6DRG7|MYPT1_DANRE | Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 | 96 | 320 | 1.0E-15 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 101 | 307 | 2.0E-15 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 1 | 319 | 2.0E-15 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 1 | 317 | 2.0E-15 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 2 | 303 | 2.0E-15 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 19 | 303 | 2.0E-15 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 103 | 303 | 3.0E-15 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 62 | 303 | 6.0E-15 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 62 | 303 | 7.0E-15 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 8.0E-15 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 1 | 322 | 9.0E-15 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 2 | 319 | 1.0E-14 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 137 | 316 | 1.0E-14 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 4 | 306 | 1.0E-14 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 104 | 320 | 1.0E-14 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 10 | 337 | 1.0E-14 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 2 | 297 | 1.0E-14 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 1 | 317 | 2.0E-14 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 13 | 319 | 2.0E-14 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 99 | 303 | 2.0E-14 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 101 | 303 | 3.0E-14 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 104 | 320 | 3.0E-14 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 3.0E-14 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 103 | 303 | 3.0E-14 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 4.0E-14 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 101 | 303 | 5.0E-14 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 15 | 302 | 5.0E-14 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 5.0E-14 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 1 | 325 | 5.0E-14 |
sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 1 | 323 | 7.0E-14 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 8.0E-14 |
sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 96 | 337 | 8.0E-14 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 1 | 347 | 9.0E-14 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 1 | 322 | 9.0E-14 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 101 | 303 | 1.0E-13 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 137 | 316 | 1.0E-13 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 102 | 284 | 1.0E-13 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 102 | 284 | 1.0E-13 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 150 | 303 | 2.0E-13 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 319 | 2.0E-13 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 97 | 284 | 2.0E-13 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 2.0E-13 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 1 | 319 | 2.0E-13 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 2 | 295 | 2.0E-13 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 103 | 302 | 3.0E-13 |
sp|Q9R172|NOTC3_RAT | Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 | 90 | 334 | 3.0E-13 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 3.0E-13 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 3.0E-13 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 3.0E-13 |
sp|Q9UM47|NOTC3_HUMAN | Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 | 90 | 334 | 3.0E-13 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 3.0E-13 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 1 | 303 | 3.0E-13 |
sp|Q61982|NOTC3_MOUSE | Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 | 90 | 334 | 3.0E-13 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 3.0E-13 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 4 | 302 | 4.0E-13 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 11 | 319 | 4.0E-13 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 102 | 302 | 4.0E-13 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 4.0E-13 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 87 | 294 | 4.0E-13 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 15 | 302 | 5.0E-13 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 10 | 337 | 5.0E-13 |
sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 92 | 303 | 5.0E-13 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 5.0E-13 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 6.0E-13 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 6.0E-13 |
sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 139 | 302 | 7.0E-13 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 1 | 319 | 8.0E-13 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 9.0E-13 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 9.0E-13 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 2 | 319 | 1.0E-12 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 1 | 347 | 1.0E-12 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 10 | 302 | 1.0E-12 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 1 | 299 | 1.0E-12 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 102 | 282 | 1.0E-12 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 1.0E-12 |
sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 102 | 291 | 1.0E-12 |
sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 96 | 337 | 1.0E-12 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 87 | 291 | 1.0E-12 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 103 | 303 | 1.0E-12 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 4 | 302 | 1.0E-12 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 3 | 297 | 2.0E-12 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 10 | 302 | 2.0E-12 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 2 | 319 | 2.0E-12 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 138 | 303 | 2.0E-12 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 79 | 316 | 2.0E-12 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 2.0E-12 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 104 | 300 | 2.0E-12 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 101 | 303 | 2.0E-12 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 2.0E-12 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 2.0E-12 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 2 | 303 | 3.0E-12 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 1 | 299 | 3.0E-12 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 10 | 302 | 3.0E-12 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 103 | 303 | 3.0E-12 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 1 | 319 | 3.0E-12 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 101 | 298 | 3.0E-12 |
sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 107 | 322 | 3.0E-12 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 1 | 307 | 3.0E-12 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 2 | 285 | 4.0E-12 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 3 | 297 | 4.0E-12 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 1 | 319 | 4.0E-12 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 4 | 302 | 4.0E-12 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 1 | 319 | 4.0E-12 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 1 | 319 | 4.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 1 | 302 | 4.0E-12 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 1 | 319 | 4.0E-12 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 4.0E-12 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 104 | 300 | 4.0E-12 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 103 | 322 | 4.0E-12 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 138 | 326 | 4.0E-12 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 4.0E-12 |
sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 140 | 322 | 5.0E-12 |
sp|Q755Y0|AKR1_ASHGO | Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 | 138 | 303 | 5.0E-12 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 1 | 307 | 6.0E-12 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 3 | 303 | 6.0E-12 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 87 | 291 | 7.0E-12 |
sp|Q6FJ70|AKR1_CANGA | Palmitoyltransferase AKR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AKR1 PE=3 SV=1 | 107 | 303 | 7.0E-12 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 1 | 319 | 8.0E-12 |
sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 96 | 320 | 8.0E-12 |
sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 96 | 337 | 8.0E-12 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 104 | 324 | 9.0E-12 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 1 | 302 | 9.0E-12 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 66 | 299 | 9.0E-12 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 103 | 303 | 9.0E-12 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 103 | 303 | 1.0E-11 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 4 | 302 | 1.0E-11 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 1 | 325 | 1.0E-11 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 4 | 319 | 1.0E-11 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 2 | 317 | 1.0E-11 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 91 | 324 | 1.0E-11 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 103 | 330 | 1.0E-11 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 178 | 307 | 1.0E-11 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 178 | 321 | 1.0E-11 |
sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 102 | 282 | 1.0E-11 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 1.0E-11 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 107 | 339 | 1.0E-11 |
sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 97 | 322 | 1.0E-11 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 178 | 307 | 1.0E-11 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 2 | 302 | 2.0E-11 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 98 | 309 | 2.0E-11 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 1 | 300 | 2.0E-11 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 103 | 325 | 2.0E-11 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 76 | 303 | 2.0E-11 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 2 | 302 | 2.0E-11 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 178 | 307 | 2.0E-11 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 103 | 322 | 2.0E-11 |
sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 91 | 298 | 2.0E-11 |
sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-11 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 178 | 319 | 2.0E-11 |
sp|Q2QLB5|ASZ1_CALMO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-11 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 104 | 303 | 2.0E-11 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 4 | 302 | 3.0E-11 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 2 | 317 | 3.0E-11 |
sp|Q108U1|ASZ1_LOXAF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 | 103 | 264 | 3.0E-11 |
sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 103 | 264 | 3.0E-11 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 3 | 282 | 3.0E-11 |
sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 107 | 303 | 3.0E-11 |
sp|P14368|V234_FOWPN | Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 | 107 | 335 | 3.0E-11 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 2 | 303 | 3.0E-11 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 3.0E-11 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 4 | 302 | 4.0E-11 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 1 | 309 | 4.0E-11 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 4.0E-11 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 104 | 303 | 4.0E-11 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 103 | 264 | 4.0E-11 |
sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 103 | 264 | 4.0E-11 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 1 | 302 | 4.0E-11 |
sp|Q07DV3|ASZ1_AOTNA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 | 103 | 264 | 4.0E-11 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 76 | 303 | 5.0E-11 |
sp|Q09YN0|ASZ1_RABIT | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 5.0E-11 |
sp|Q2IBG0|ASZ1_EULMM | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 | 103 | 264 | 6.0E-11 |
sp|Q9NXR5|ANR10_HUMAN | Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 | 178 | 330 | 6.0E-11 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 139 | 322 | 6.0E-11 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 178 | 319 | 7.0E-11 |
sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 108 | 334 | 7.0E-11 |
sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 108 | 334 | 7.0E-11 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 66 | 303 | 7.0E-11 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 302 | 8.0E-11 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 150 | 321 | 8.0E-11 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 1 | 304 | 8.0E-11 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 1 | 308 | 8.0E-11 |
sp|Q09YK6|ASZ1_ATEGE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 | 103 | 264 | 8.0E-11 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 101 | 321 | 8.0E-11 |
sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 48 | 303 | 8.0E-11 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 4 | 302 | 9.0E-11 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 1 | 302 | 1.0E-10 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 3 | 319 | 1.0E-10 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 3 | 330 | 1.0E-10 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 1 | 302 | 1.0E-10 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 80 | 298 | 1.0E-10 |
sp|Q09YH1|ASZ1_SAIBB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 | 103 | 264 | 1.0E-10 |
sp|Q2QLG0|ASZ1_CALJA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 | 103 | 265 | 1.0E-10 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 38 | 315 | 1.0E-10 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 104 | 282 | 1.0E-10 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 3 | 298 | 1.0E-10 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 178 | 303 | 1.0E-10 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 104 | 282 | 1.0E-10 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 3 | 298 | 1.0E-10 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 178 | 319 | 1.0E-10 |
sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 139 | 299 | 1.0E-10 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 4 | 298 | 1.0E-10 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 182 | 303 | 1.0E-10 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 104 | 252 | 1.0E-10 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 9 | 325 | 2.0E-10 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 17 | 302 | 2.0E-10 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 3 | 252 | 2.0E-10 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 141 | 302 | 2.0E-10 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 1 | 303 | 2.0E-10 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 98 | 309 | 2.0E-10 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 103 | 264 | 2.0E-10 |
sp|P13508|GLP1_CAEEL | Protein glp-1 OS=Caenorhabditis elegans GN=glp-1 PE=1 SV=1 | 104 | 332 | 2.0E-10 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 3 | 298 | 2.0E-10 |
sp|Q07E30|ASZ1_NEONE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-10 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 1 | 303 | 2.0E-10 |
sp|Q2QLH1|ASZ1_OTOGA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-10 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 103 | 259 | 2.0E-10 |
sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 65 | 282 | 2.0E-10 |
sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 108 | 334 | 2.0E-10 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 104 | 322 | 2.0E-10 |
sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 178 | 322 | 2.0E-10 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 152 | 336 | 2.0E-10 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-10 |
sp|Q09701|AKR1_SCHPO | Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 | 104 | 328 | 2.0E-10 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 17 | 344 | 2.0E-10 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 103 | 264 | 2.0E-10 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 4 | 302 | 3.0E-10 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 1 | 298 | 3.0E-10 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 17 | 302 | 3.0E-10 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 1 | 325 | 3.0E-10 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 1 | 319 | 3.0E-10 |
sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 103 | 264 | 3.0E-10 |
sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 104 | 322 | 3.0E-10 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 83 | 303 | 3.0E-10 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 94 | 328 | 3.0E-10 |
sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 103 | 264 | 3.0E-10 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 169 | 307 | 3.0E-10 |
sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 103 | 264 | 3.0E-10 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 1 | 302 | 3.0E-10 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 104 | 322 | 3.0E-10 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 1 | 302 | 4.0E-10 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 1 | 325 | 4.0E-10 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 1 | 302 | 4.0E-10 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 139 | 307 | 4.0E-10 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 103 | 303 | 4.0E-10 |
sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 103 | 264 | 4.0E-10 |
sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 103 | 290 | 4.0E-10 |
sp|Q99LW0|ANR10_MOUSE | Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 | 178 | 322 | 4.0E-10 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 112 | 334 | 4.0E-10 |
sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 103 | 264 | 4.0E-10 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 65 | 302 | 4.0E-10 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 13 | 325 | 5.0E-10 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 1 | 315 | 5.0E-10 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 103 | 300 | 5.0E-10 |
sp|Q875M2|AKR1_KLULA | Palmitoyltransferase AKR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AKR1 PE=3 SV=1 | 138 | 303 | 5.0E-10 |
sp|Q5AL27|AKR1_CANAL | Palmitoyltransferase AKR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AKR1 PE=3 SV=1 | 74 | 303 | 5.0E-10 |
sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 5.0E-10 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 2 | 302 | 6.0E-10 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 97 | 285 | 6.0E-10 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 178 | 294 | 6.0E-10 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 104 | 320 | 7.0E-10 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 104 | 303 | 7.0E-10 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 1 | 321 | 7.0E-10 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 65 | 319 | 8.0E-10 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 103 | 337 | 8.0E-10 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 139 | 308 | 8.0E-10 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 103 | 264 | 8.0E-10 |
sp|P14585|LIN12_CAEEL | Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 | 104 | 333 | 9.0E-10 |
sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 103 | 264 | 9.0E-10 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 4 | 315 | 9.0E-10 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 103 | 321 | 1.0E-09 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 1 | 302 | 1.0E-09 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 1 | 319 | 1.0E-09 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 101 | 312 | 1.0E-09 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 178 | 303 | 1.0E-09 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 104 | 298 | 1.0E-09 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 103 | 319 | 1.0E-09 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 10 | 298 | 1.0E-09 |
sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 144 | 302 | 1.0E-09 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 178 | 302 | 1.0E-09 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 65 | 321 | 2.0E-09 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 103 | 321 | 2.0E-09 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 1 | 315 | 2.0E-09 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 1 | 319 | 2.0E-09 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 4 | 302 | 2.0E-09 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 103 | 303 | 2.0E-09 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 139 | 307 | 2.0E-09 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 139 | 307 | 2.0E-09 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 1 | 308 | 2.0E-09 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 95 | 332 | 2.0E-09 |
sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 150 | 316 | 2.0E-09 |
sp|Q3V0J4|ANR53_MOUSE | Ankyrin repeat domain-containing protein 53 OS=Mus musculus GN=Ankrd53 PE=2 SV=2 | 205 | 319 | 2.0E-09 |
sp|Q7EZ44|XB35_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 | 59 | 303 | 2.0E-09 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 1 | 321 | 2.0E-09 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 104 | 303 | 2.0E-09 |
sp|Q09YI3|ASZ1_SHEEP | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 | 104 | 340 | 2.0E-09 |
sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 2.0E-09 |
sp|P0CS66|AKR1_CRYNJ | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 | 138 | 320 | 2.0E-09 |
sp|P0CS67|AKR1_CRYNB | Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 | 138 | 320 | 2.0E-09 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 104 | 282 | 2.0E-09 |
sp|Q8N9B4|ANR42_HUMAN | Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 | 113 | 325 | 2.0E-09 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 1 | 298 | 3.0E-09 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 107 | 294 | 3.0E-09 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 101 | 303 | 3.0E-09 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 101 | 322 | 3.0E-09 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 1 | 319 | 3.0E-09 |
sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 1 | 295 | 3.0E-09 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 102 | 291 | 3.0E-09 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 177 | 298 | 3.0E-09 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 110 | 321 | 3.0E-09 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 4 | 298 | 3.0E-09 |
sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 8 | 329 | 3.0E-09 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 101 | 287 | 3.0E-09 |
sp|Q8N7Z5|ANR31_HUMAN | Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 | 171 | 311 | 3.0E-09 |
sp|P55273|CDN2D_HUMAN | Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens GN=CDKN2D PE=1 SV=1 | 165 | 300 | 3.0E-09 |
sp|Q5VYY1|ANR22_HUMAN | Ankyrin repeat domain-containing protein 22 OS=Homo sapiens GN=ANKRD22 PE=2 SV=1 | 178 | 328 | 3.0E-09 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 32 | 321 | 4.0E-09 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 195 | 327 | 4.0E-09 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 182 | 327 | 4.0E-09 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 182 | 327 | 4.0E-09 |
sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 104 | 289 | 4.0E-09 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 139 | 308 | 4.0E-09 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 139 | 308 | 4.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 103 | 303 | 4.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 27 | 298 | 4.0E-09 |
sp|Q8WMX8|ASZ1_BOVIN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 | 104 | 264 | 4.0E-09 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 10 | 295 | 4.0E-09 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 101 | 287 | 4.0E-09 |
sp|Q8TF21|ANR24_HUMAN | Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 | 179 | 306 | 4.0E-09 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 104 | 299 | 4.0E-09 |
sp|Q29RV0|CDN2D_BOVIN | Cyclin-dependent kinase 4 inhibitor D OS=Bos taurus GN=CDKN2D PE=2 SV=1 | 167 | 300 | 4.0E-09 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 107 | 302 | 5.0E-09 |
sp|Q875S9|AKR1_LACK1 | Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 | 138 | 303 | 5.0E-09 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 104 | 298 | 5.0E-09 |
sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 55 | 293 | 5.0E-09 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 179 | 303 | 5.0E-09 |
sp|Q9Y566|SHAN1_HUMAN | SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 | 87 | 322 | 5.0E-09 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 182 | 303 | 6.0E-09 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 170 | 312 | 6.0E-09 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 139 | 308 | 6.0E-09 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 179 | 303 | 6.0E-09 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 103 | 325 | 6.0E-09 |
sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 151 | 322 | 6.0E-09 |
sp|Q86AT8|SPKA_DICDI | Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 | 17 | 203 | 6.0E-09 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 1 | 316 | 6.0E-09 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 195 | 327 | 7.0E-09 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 175 | 303 | 7.0E-09 |
sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 174 | 287 | 7.0E-09 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 103 | 319 | 7.0E-09 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 7.0E-09 |
sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 103 | 303 | 7.0E-09 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 1 | 302 | 8.0E-09 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 103 | 297 | 8.0E-09 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 104 | 299 | 8.0E-09 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 139 | 322 | 8.0E-09 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 1 | 319 | 9.0E-09 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 104 | 279 | 9.0E-09 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 178 | 322 | 9.0E-09 |
sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 174 | 303 | 9.0E-09 |
sp|Q6F3J0|NFKB1_CANLF | Nuclear factor NF-kappa-B p105 subunit OS=Canis lupus familiaris GN=NFKB1 PE=2 SV=2 | 174 | 287 | 9.0E-09 |
sp|Q96NS5|ASB16_HUMAN | Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 | 178 | 319 | 9.0E-09 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 138 | 340 | 1.0E-08 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 195 | 327 | 1.0E-08 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 104 | 319 | 1.0E-08 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 103 | 299 | 1.0E-08 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 103 | 303 | 1.0E-08 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 2 | 295 | 1.0E-08 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 1 | 325 | 1.0E-08 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 97 | 319 | 1.0E-08 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 19 | 302 | 1.0E-08 |
sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 147 | 306 | 1.0E-08 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 232 | 318 | 1.0E-08 |
sp|Q4ULZ2|Y580_RICFE | Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 | 135 | 303 | 1.0E-08 |
sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 174 | 319 | 1.0E-08 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 179 | 303 | 1.0E-08 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 232 | 318 | 1.0E-08 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 103 | 330 | 1.0E-08 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 179 | 303 | 1.0E-08 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 3 | 319 | 1.0E-08 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 195 | 342 | 2.0E-08 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 195 | 342 | 2.0E-08 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 103 | 297 | 2.0E-08 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 4 | 321 | 2.0E-08 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 139 | 303 | 2.0E-08 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 4 | 271 | 2.0E-08 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 179 | 303 | 2.0E-08 |
sp|Q9WV48|SHAN1_RAT | SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 | 87 | 322 | 2.0E-08 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 104 | 319 | 2.0E-08 |
sp|Q04749|AVO2_YEAST | Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1 | 141 | 306 | 2.0E-08 |
sp|Q9D3J5|ANR22_MOUSE | Ankyrin repeat domain-containing protein 22 OS=Mus musculus GN=Ankrd22 PE=2 SV=1 | 178 | 321 | 2.0E-08 |
sp|D3YZU1|SHAN1_MOUSE | SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=1 SV=1 | 87 | 322 | 2.0E-08 |
sp|Q09YJ5|ASZ1_MUNMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 | 104 | 259 | 2.0E-08 |
sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 96 | 285 | 2.0E-08 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 101 | 306 | 2.0E-08 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 104 | 319 | 2.0E-08 |
sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 118 | 339 | 2.0E-08 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 111 | 282 | 2.0E-08 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 150 | 337 | 2.0E-08 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 138 | 340 | 3.0E-08 |
sp|Q755Y0|AKR1_ASHGO | Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 | 104 | 295 | 3.0E-08 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 101 | 298 | 3.0E-08 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 175 | 303 | 3.0E-08 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 178 | 322 | 3.0E-08 |
sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 115 | 282 | 3.0E-08 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 149 | 303 | 3.0E-08 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 157 | 316 | 3.0E-08 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 232 | 318 | 3.0E-08 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 232 | 318 | 3.0E-08 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 149 | 317 | 3.0E-08 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 232 | 318 | 3.0E-08 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 149 | 317 | 3.0E-08 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 232 | 318 | 3.0E-08 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 149 | 317 | 3.0E-08 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 232 | 318 | 3.0E-08 |
sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 87 | 297 | 3.0E-08 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 149 | 317 | 3.0E-08 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 226 | 318 | 3.0E-08 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 152 | 303 | 3.0E-08 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 104 | 300 | 3.0E-08 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 3 | 319 | 3.0E-08 |
sp|P19838|NFKB1_HUMAN | Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 | 171 | 287 | 3.0E-08 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 139 | 308 | 4.0E-08 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 103 | 303 | 4.0E-08 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 139 | 322 | 4.0E-08 |
sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 174 | 319 | 4.0E-08 |
sp|Q07DZ7|ASZ1_ORNAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 | 103 | 264 | 4.0E-08 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 149 | 303 | 4.0E-08 |
sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 174 | 319 | 4.0E-08 |
sp|Q9Z2F6|BCL3_MOUSE | B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 | 75 | 323 | 4.0E-08 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 138 | 316 | 5.0E-08 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 156 | 303 | 5.0E-08 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 179 | 308 | 5.0E-08 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 91 | 344 | 6.0E-08 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 175 | 300 | 6.0E-08 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 2 | 276 | 6.0E-08 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 112 | 303 | 6.0E-08 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 179 | 303 | 6.0E-08 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 10 | 324 | 6.0E-08 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 88 | 231 | 6.0E-08 |
sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 104 | 300 | 6.0E-08 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 3 | 328 | 6.0E-08 |
sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 140 | 321 | 6.0E-08 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 38 | 290 | 6.0E-08 |
sp|Q95N27|PP16B_BOVIN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 | 138 | 301 | 6.0E-08 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 103 | 303 | 6.0E-08 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 104 | 219 | 7.0E-08 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 101 | 330 | 7.0E-08 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 178 | 316 | 7.0E-08 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 179 | 303 | 7.0E-08 |
sp|P20749|BCL3_HUMAN | B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 | 48 | 323 | 7.0E-08 |
sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 104 | 300 | 7.0E-08 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 182 | 320 | 8.0E-08 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 103 | 319 | 8.0E-08 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 182 | 319 | 8.0E-08 |
sp|Q8N9V6|ANR53_HUMAN | Ankyrin repeat domain-containing protein 53 OS=Homo sapiens GN=ANKRD53 PE=2 SV=3 | 205 | 303 | 8.0E-08 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 182 | 303 | 9.0E-08 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 139 | 303 | 9.0E-08 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 103 | 297 | 9.0E-08 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 100 | 328 | 9.0E-08 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 107 | 322 | 1.0E-07 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 175 | 298 | 1.0E-07 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 182 | 320 | 1.0E-07 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 103 | 286 | 1.0E-07 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 103 | 316 | 1.0E-07 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 143 | 317 | 1.0E-07 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 143 | 303 | 1.0E-07 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 149 | 317 | 1.0E-07 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 1 | 321 | 1.0E-07 |
sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 188 | 288 | 1.0E-07 |
sp|Q4R739|ANR53_MACFA | Ankyrin repeat domain-containing protein 53 OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1 | 205 | 303 | 1.0E-07 |
sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 178 | 319 | 1.0E-07 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 178 | 316 | 1.0E-07 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 104 | 316 | 1.0E-07 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 104 | 316 | 1.0E-07 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 103 | 318 | 1.0E-07 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 104 | 316 | 1.0E-07 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 103 | 302 | 1.0E-07 |
sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 194 | 288 | 1.0E-07 |
sp|Q6NXT1|ANR54_HUMAN | Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 | 188 | 288 | 1.0E-07 |
sp|Q63369|NFKB1_RAT | Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 | 171 | 287 | 1.0E-07 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 107 | 322 | 2.0E-07 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 107 | 322 | 2.0E-07 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 139 | 319 | 2.0E-07 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 139 | 319 | 2.0E-07 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 1 | 299 | 2.0E-07 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 1 | 237 | 2.0E-07 |
sp|Q8T2Q0|ZDHC6_DICDI | Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 | 99 | 220 | 2.0E-07 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 1 | 319 | 2.0E-07 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 103 | 286 | 2.0E-07 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 2 | 295 | 2.0E-07 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 179 | 340 | 2.0E-07 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 4 | 315 | 2.0E-07 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 149 | 317 | 2.0E-07 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 149 | 317 | 2.0E-07 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 101 | 347 | 2.0E-07 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 23 | 316 | 2.0E-07 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 156 | 303 | 2.0E-07 |
sp|Q8VHQ3|PP16B_MOUSE | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 | 138 | 301 | 2.0E-07 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 156 | 302 | 2.0E-07 |
sp|Q54KH3|ANR39_DICDI | Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 | 193 | 306 | 2.0E-07 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 104 | 296 | 2.0E-07 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 179 | 316 | 2.0E-07 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 3 | 328 | 2.0E-07 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 4 | 220 | 2.0E-07 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 139 | 316 | 2.0E-07 |
sp|Q96T49|PP16B_HUMAN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 | 138 | 301 | 2.0E-07 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 200 | 303 | 2.0E-07 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 8 | 220 | 2.0E-07 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 3 | 328 | 2.0E-07 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 1 | 200 | 3.0E-07 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 1 | 303 | 3.0E-07 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 1 | 319 | 3.0E-07 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 14 | 175 | 3.0E-07 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 178 | 321 | 3.0E-07 |
sp|Q5UR04|YR911_MIMIV | Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 | 1 | 307 | 3.0E-07 |
sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 146 | 340 | 3.0E-07 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 21 | 285 | 3.0E-07 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 175 | 302 | 3.0E-07 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 97 | 297 | 3.0E-07 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 149 | 317 | 3.0E-07 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 101 | 298 | 3.0E-07 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 200 | 303 | 3.0E-07 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 103 | 319 | 3.0E-07 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 100 | 319 | 3.0E-07 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 103 | 303 | 3.0E-07 |
sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 116 | 346 | 3.0E-07 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 103 | 303 | 3.0E-07 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 156 | 319 | 4.0E-07 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 179 | 320 | 4.0E-07 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 14 | 175 | 4.0E-07 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 178 | 303 | 4.0E-07 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 179 | 319 | 4.0E-07 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 116 | 303 | 4.0E-07 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 179 | 308 | 4.0E-07 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 11 | 298 | 4.0E-07 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 204 | 309 | 4.0E-07 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 8 | 220 | 4.0E-07 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 248 | 303 | 4.0E-07 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 200 | 303 | 4.0E-07 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 104 | 316 | 4.0E-07 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 103 | 303 | 5.0E-07 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 149 | 316 | 5.0E-07 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 210 | 309 | 5.0E-07 |
sp|Q6DGX3|ANR54_DANRE | Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 | 179 | 297 | 5.0E-07 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 1 | 303 | 5.0E-07 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 200 | 319 | 5.0E-07 |
sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 201 | 303 | 5.0E-07 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 178 | 300 | 6.0E-07 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 104 | 304 | 6.0E-07 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 183 | 302 | 6.0E-07 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 178 | 303 | 6.0E-07 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 1 | 301 | 6.0E-07 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 179 | 340 | 6.0E-07 |
sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 176 | 319 | 6.0E-07 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 1 | 298 | 6.0E-07 |
sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 61 | 293 | 6.0E-07 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 103 | 342 | 6.0E-07 |
sp|P25799|NFKB1_MOUSE | Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 | 171 | 287 | 6.0E-07 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 107 | 319 | 7.0E-07 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 175 | 298 | 7.0E-07 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 1 | 200 | 7.0E-07 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 2 | 306 | 7.0E-07 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 4 | 315 | 7.0E-07 |
sp|Q5NVB9|ZDH13_PONAB | Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 | 104 | 282 | 7.0E-07 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 1 | 321 | 7.0E-07 |
sp|Q9CWU2|ZDH13_MOUSE | Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 | 174 | 334 | 7.0E-07 |
sp|Q0P5B9|ANR39_BOVIN | Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 | 186 | 300 | 7.0E-07 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 114 | 344 | 7.0E-07 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 163 | 319 | 7.0E-07 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 97 | 285 | 7.0E-07 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 139 | 286 | 8.0E-07 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 175 | 298 | 8.0E-07 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 178 | 316 | 8.0E-07 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 1 | 323 | 8.0E-07 |
sp|Q8IUH4|ZDH13_HUMAN | Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 | 104 | 282 | 8.0E-07 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 179 | 308 | 8.0E-07 |
sp|Q8K4M9|OSBL1_RAT | Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 | 99 | 307 | 8.0E-07 |
sp|Q60773|CDN2D_MOUSE | Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus GN=Cdkn2d PE=1 SV=2 | 165 | 300 | 8.0E-07 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 200 | 319 | 8.0E-07 |
sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 190 | 325 | 8.0E-07 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 3 | 219 | 9.0E-07 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 8 | 220 | 9.0E-07 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 103 | 303 | 9.0E-07 |
sp|Q9SCX5|AKT5_ARATH | Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 | 156 | 303 | 9.0E-07 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 103 | 297 | 1.0E-06 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 179 | 320 | 1.0E-06 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 104 | 319 | 1.0E-06 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 104 | 319 | 1.0E-06 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 1 | 319 | 1.0E-06 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 178 | 316 | 1.0E-06 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 113 | 311 | 1.0E-06 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 172 | 319 | 1.0E-06 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 1 | 201 | 1.0E-06 |
sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 114 | 216 | 1.0E-06 |
sp|Q91XL9|OSBL1_MOUSE | Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 | 99 | 342 | 1.0E-06 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 104 | 326 | 1.0E-06 |
sp|Q58CT0|DYH12_BOVIN | Dynein heavy chain 12, axonemal OS=Bos taurus GN=DNAH12 PE=2 SV=1 | 186 | 330 | 1.0E-06 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 103 | 303 | 1.0E-06 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 151 | 302 | 1.0E-06 |
sp|Q9BZL4|PP12C_HUMAN | Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 | 138 | 322 | 1.0E-06 |
sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 78 | 281 | 1.0E-06 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 1 | 302 | 2.0E-06 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 149 | 302 | 2.0E-06 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 1 | 302 | 2.0E-06 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 194 | 319 | 2.0E-06 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 68 | 212 | 2.0E-06 |
sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 68 | 212 | 2.0E-06 |
sp|Q5ZLC6|ANR10_CHICK | Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 | 103 | 246 | 2.0E-06 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 121 | 319 | 2.0E-06 |
sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 103 | 252 | 2.0E-06 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 190 | 322 | 2.0E-06 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 204 | 309 | 2.0E-06 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 113 | 311 | 2.0E-06 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 113 | 311 | 2.0E-06 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 203 | 314 | 2.0E-06 |
sp|Q3UMT1|PP12C_MOUSE | Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 | 138 | 322 | 2.0E-06 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 3 | 319 | 2.0E-06 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 151 | 302 | 2.0E-06 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 151 | 302 | 2.0E-06 |
sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 78 | 291 | 2.0E-06 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 248 | 303 | 2.0E-06 |
sp|Q1LZC5|ANR54_BOVIN | Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 | 188 | 288 | 2.0E-06 |
sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 178 | 327 | 2.0E-06 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 104 | 320 | 2.0E-06 |
sp|Q9BXW6|OSBL1_HUMAN | Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 | 99 | 342 | 2.0E-06 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 103 | 319 | 2.0E-06 |
sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 179 | 309 | 2.0E-06 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 135 | 291 | 2.0E-06 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 116 | 282 | 3.0E-06 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 3 | 219 | 3.0E-06 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 3.0E-06 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 3.0E-06 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 3.0E-06 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 103 | 319 | 3.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 21 | 285 | 3.0E-06 |
sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 175 | 306 | 3.0E-06 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 179 | 298 | 3.0E-06 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 103 | 309 | 3.0E-06 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 103 | 319 | 3.0E-06 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 37 | 258 | 3.0E-06 |
sp|Q99728|BARD1_HUMAN | BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 | 179 | 322 | 3.0E-06 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 101 | 319 | 3.0E-06 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 139 | 321 | 3.0E-06 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 151 | 302 | 3.0E-06 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 3 | 219 | 4.0E-06 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 178 | 305 | 4.0E-06 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 1 | 318 | 4.0E-06 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 198 | 345 | 4.0E-06 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 178 | 305 | 4.0E-06 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 1 | 175 | 4.0E-06 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 179 | 298 | 4.0E-06 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 151 | 302 | 4.0E-06 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 179 | 303 | 4.0E-06 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 1 | 212 | 4.0E-06 |
sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 104 | 251 | 4.0E-06 |
sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 171 | 303 | 4.0E-06 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 3 | 319 | 4.0E-06 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 175 | 322 | 5.0E-06 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 5.0E-06 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 5.0E-06 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 149 | 308 | 5.0E-06 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 179 | 298 | 5.0E-06 |
sp|Q554E7|ZDHC5_DICDI | Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 | 139 | 322 | 5.0E-06 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 248 | 303 | 5.0E-06 |
sp|Q9BZF9|UACA_HUMAN | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 | 149 | 303 | 5.0E-06 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 1 | 302 | 6.0E-06 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 6.0E-06 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 6.0E-06 |
sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 239 | 333 | 6.0E-06 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 210 | 302 | 6.0E-06 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 186 | 300 | 6.0E-06 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 175 | 322 | 7.0E-06 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 7.0E-06 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 104 | 300 | 7.0E-06 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 7.0E-06 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 133 | 316 | 7.0E-06 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 210 | 302 | 7.0E-06 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 178 | 321 | 7.0E-06 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 78 | 289 | 7.0E-06 |
sp|Q4R690|ZDH13_MACFA | Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 | 104 | 282 | 7.0E-06 |
sp|Q91WK7|ANR54_MOUSE | Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 | 94 | 215 | 7.0E-06 |
sp|Q566C8|ANR54_RAT | Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 | 94 | 215 | 7.0E-06 |
sp|Q4FE45|XB33_ARATH | E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 | 135 | 302 | 7.0E-06 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 178 | 316 | 7.0E-06 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 151 | 302 | 7.0E-06 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 179 | 316 | 7.0E-06 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 182 | 313 | 7.0E-06 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 104 | 302 | 8.0E-06 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 3 | 219 | 8.0E-06 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 99 | 322 | 8.0E-06 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 103 | 219 | 8.0E-06 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 179 | 309 | 8.0E-06 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 182 | 313 | 8.0E-06 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 179 | 316 | 8.0E-06 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 9.0E-06 |
sp|Q00PJ3|ASZ1_ATEAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 | 149 | 321 | 9.0E-06 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 178 | 305 | 9.0E-06 |
sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 179 | 306 | 9.0E-06 |
sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 139 | 292 | 9.0E-06 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 179 | 309 | 9.0E-06 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 179 | 307 | 1.0E-05 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 139 | 319 | 1.0E-05 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 104 | 319 | 1.0E-05 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 139 | 303 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 14 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|2655 MKLLLSYGADVDAADDGGTALAIAAWNGDDEVAELLINHGASLKDVRGADVNIAAVREIGVFSDIRGEKTALQRA VLCIFEGDINHDKGLATVTNAEIELEPPLFWAATGGSPEVVSRLLSAGADATARVKNIAGGLVTALERGCLSKNV QVVDLLLKAGADVKAENRFHKTALEQPPLHTAIRFGTVGMIGLLVRGGADVDAQDQEGWTALHKAARRGEEMGPE MTEVLLTEFKANYTLPTVNGGLPVHVAAAVDNVECLALLVRAGSDINAVDLAGKTPLHWAADKGALRAIEWLMRH GADDGVEACETGMTALDYAERRLREAHLRHHVVRRRKVLAALSNKTA* |
Coding | >Ophun1|2655 ATGAAGCTGCTGTTATCCTACGGTGCGGACGTGGACGCAGCTGACGATGGCGGAACGGCTCTAGCAATTGCTGCT TGGAACGGAGACGACGAGGTCGCCGAGTTGCTCATCAATCATGGCGCCTCGCTGAAGGACGTCAGGGGAGCCGAC GTCAATATCGCGGCGGTTCGCGAAATCGGAGTCTTTTCTGACATTAGAGGGGAAAAGACGGCACTTCAAAGGGCA GTTCTCTGTATTTTCGAAGGCGACATAAACCACGACAAAGGTCTAGCCACCGTTACCAACGCAGAAATTGAACTG GAACCGCCGCTCTTCTGGGCAGCAACTGGAGGGTCCCCGGAGGTAGTATCTCGACTCCTATCCGCAGGCGCAGAT GCCACAGCTCGCGTCAAGAACATCGCAGGTGGCCTCGTCACCGCCCTAGAAAGAGGCTGCTTAAGCAAAAACGTC CAAGTCGTCGACCTCCTTCTCAAGGCGGGCGCCGACGTGAAAGCAGAGAACCGCTTCCACAAAACCGCCCTCGAG CAGCCACCGCTCCATACAGCCATTCGCTTCGGCACCGTGGGAATGATTGGCTTGCTTGTCCGTGGCGGAGCTGAC GTCGATGCACAGGATCAAGAGGGCTGGACAGCGCTGCACAAGGCCGCGAGACGGGGCGAAGAGATGGGCCCAGAG ATGACCGAGGTGCTTCTCACCGAGTTCAAGGCCAATTATACGCTGCCGACGGTGAACGGTGGTCTCCCGGTTCAC GTGGCGGCCGCTGTTGATAACGTGGAGTGCTTGGCGCTGCTGGTGCGGGCTGGGTCGGATATCAATGCGGTGGAT CTAGCTGGGAAGACGCCGCTTCACTGGGCGGCTGATAAAGGGGCTTTACGGGCTATCGAATGGTTGATGAGGCAT GGGGCTGATGATGGTGTGGAAGCTTGCGAGACGGGCATGACGGCTTTGGATTATGCCGAGCGAAGGTTGCGAGAG GCACATTTGCGGCATCACGTTGTTAGGAGGAGGAAGGTGCTCGCGGCGTTGAGCAACAAGACAGCCTGA |
Transcript | >Ophun1|2655 ATGAAGCTGCTGTTATCCTACGGTGCGGACGTGGACGCAGCTGACGATGGCGGAACGGCTCTAGCAATTGCTGCT TGGAACGGAGACGACGAGGTCGCCGAGTTGCTCATCAATCATGGCGCCTCGCTGAAGGACGTCAGGGGAGCCGAC GTCAATATCGCGGCGGTTCGCGAAATCGGAGTCTTTTCTGACATTAGAGGGGAAAAGACGGCACTTCAAAGGGCA GTTCTCTGTATTTTCGAAGGCGACATAAACCACGACAAAGGTCTAGCCACCGTTACCAACGCAGAAATTGAACTG GAACCGCCGCTCTTCTGGGCAGCAACTGGAGGGTCCCCGGAGGTAGTATCTCGACTCCTATCCGCAGGCGCAGAT GCCACAGCTCGCGTCAAGAACATCGCAGGTGGCCTCGTCACCGCCCTAGAAAGAGGCTGCTTAAGCAAAAACGTC CAAGTCGTCGACCTCCTTCTCAAGGCGGGCGCCGACGTGAAAGCAGAGAACCGCTTCCACAAAACCGCCCTCGAG CAGCCACCGCTCCATACAGCCATTCGCTTCGGCACCGTGGGAATGATTGGCTTGCTTGTCCGTGGCGGAGCTGAC GTCGATGCACAGGATCAAGAGGGCTGGACAGCGCTGCACAAGGCCGCGAGACGGGGCGAAGAGATGGGCCCAGAG ATGACCGAGGTGCTTCTCACCGAGTTCAAGGCCAATTATACGCTGCCGACGGTGAACGGTGGTCTCCCGGTTCAC GTGGCGGCCGCTGTTGATAACGTGGAGTGCTTGGCGCTGCTGGTGCGGGCTGGGTCGGATATCAATGCGGTGGAT CTAGCTGGGAAGACGCCGCTTCACTGGGCGGCTGATAAAGGGGCTTTACGGGCTATCGAATGGTTGATGAGGCAT GGGGCTGATGATGGTGTGGAAGCTTGCGAGACGGGCATGACGGCTTTGGATTATGCCGAGCGAAGGTTGCGAGAG GCACATTTGCGGCATCACGTTGTTAGGAGGAGGAAGGTGCTCGCGGCGTTGAGCAACAAGACAGCCTGA |
Gene | >Ophun1|2655 ATGAAGCTGCTGTTATCCTACGGTGCGGACGTGGACGCAGCTGACGATGGCGGAACGGCTCTAGCAATTGCTGCT TGGAACGGAGACGACGAGGTCGCCGAGTTGCTCATCAATCATGGCGCCTCGCTGAAGGACGTCAGGGGTGAGTGT GGCGGGCCAGTTCACGCCGCCATACTGAGAGGCAACCTTGGTATTCTGAAGCTGCTAGTCGCTAAAGGAGCCGAC GTCAATATCGCGGCGGTTCGCGAAATCGGAGTCTTTTCTGACATTAGAGGGGAAAAGACGGCACTTCAAAGGGCA GTTCTCTGTATTTTCGAAGGCGACATAAACCACGACAAAGGTCTAGCCACCGTTACCAACGCAGAAATTGAACTG GAACCGCCGCTCTTCTGGGCAGCAACTGGAGGGTCCCCGGAGGTAGTATCTCGACTCCTATCCGCAGGCGCAGAT GCCACAGCTCGCGTCAAGAACATCGCAGGTGGCCTCGTCACCGCCCTAGAAAGAGGCTGCTTAAGCAAAAACGTC CAAGTCGTCGACCTCCTTCTCAAGGCGGGCGCCGACGTGAAAGCAGAGAACCGCTTCCACAAAACCGCCCTCGAG CAGCCACCGCTCCATACAGCCATTCGCTTCGGCACCGTGGGAATGATTGGCTTGCTTGTCCGTGGCGGAGCTGAC GTCGATGCACAGGATCAAGAGGGCTGGACAGCGCTGCACAAGGCCGCGAGACGGGGCGAAGAGATGGGCCCAGAG ATGACCGAGGTGCTTCTCACCGAGTTCAAGGCCAATTATACGCTGCCGACGGTGAACGGTGGTCTCCCGGTTCAC GTGGCGGCCGCTGTTGATAACGTGGAGTGCTTGGCGCTGCTGGTGCGGGCTGGGTCGGATATCAATGCGGTGGAT CTAGCTGGGAAGACGCCGCTTCACTGGGCGGCTGATAAAGGGGCTTTACGGGCTATCGAATGGTTGATGAGGCAT GGGGCTGATGATGGTGTGGAAGCTTGCGAGACGGGCATGACGGCTTTGGATTATGCCGAGCGAAGGTTGCGAGAG GCACATTTGCGGCATCACGTTGTTAGGAGGAGGAAGGTGCTCGCGGCGTTGAGCAACAAGACAGCCTGA |