Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2650
Gene name
LocationContig_237:13914..17522
Strand-
Gene length (bp)3608
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13513 HEAT_EZ HEAT-like repeat 1.0E-07 359 407
PF02985 HEAT HEAT repeat 2.8E-03 386 414
PF03810 IBN_N Importin-beta N-terminal domain 1.4E-05 30 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap123 PE=3 SV=1 6 1103 2.0E-166
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 1 1078 9.0E-125
sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens GN=IPO4 PE=1 SV=2 16 1064 4.0E-43
sp|Q8VI75|IPO4_MOUSE Importin-4 OS=Mus musculus GN=Ipo4 PE=1 SV=1 1 626 1.0E-29
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 6 605 3.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60100|IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap123 PE=3 SV=1 6 1103 2.0E-166
sp|P40069|IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP123 PE=1 SV=1 1 1078 9.0E-125
sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens GN=IPO4 PE=1 SV=2 16 1064 4.0E-43
sp|Q8VI75|IPO4_MOUSE Importin-4 OS=Mus musculus GN=Ipo4 PE=1 SV=1 1 626 1.0E-29
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 6 605 3.0E-21
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 21 1048 2.0E-17
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 21 1048 1.0E-16
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 2 602 4.0E-13
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 63 565 4.0E-10
sp|Q8VI75|IPO4_MOUSE Importin-4 OS=Mus musculus GN=Ipo4 PE=1 SV=1 790 1075 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0005515 protein binding Yes
GO:0019899 enzyme binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0045184 establishment of protein localization No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0051020 GTPase binding No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2650
MDKDRLVQLLQASQVPNTEQVKAVTADLQKNFYSQPESLLLLIEVTLTHADGALRQLAAVQALRLVSKHWKPTPE
DKKALARSHLLDGTLKETSLSIRHSMARLLAGIVGIDLELGQGDDFLKQLLPLNNSDNVVAREVGSFILFSMLED
DPTHFSGYIPQLLQLFRSRIKDPDSKEVQINIVQAISAMLLILDPEENPEGLATMQSFMPDLVNILKVAVEVGDD
EGYRTVFEVFHSFLAYDPALLSVHLHDLLQFMIDLAANADAEEDARTQALGFLIQCVRYRRMKIQGMKDMGAQLM
VKAMQIVGSLDADDDDEDLSPARTAISLINTLASELPPRQVVVPLLDQFPSYATSSHPGLRMASVLALGNAAEGA
PDFVSTQLQPLLPTILNLLCDSDGQVRHAALVGLIHLAEEMADEMASKHEEIISAVLNNLEAAAQGPSDKQKVSI
IRSACGALDTFGDGVDTKIMAQFGPSLIGPMVKLLDHDDFGVKAAAASAIGAIASSMGNAFEPYFKGVMEALAKF
VMLKDDDDAMNLRSSTCDSLGRIAMSVGADAFQPYVMDLMKASEEALSLDNPRLKETSFILWSNLSKVYREQFNH
FLDGVFKGIFASLELEETELEIPDVDPSLLADGAIFGGKRVKLKSADDMATAIDEGEWDDLDSMEDLGAVTAVAL
EQEIALEVLGDVVTNCCNSANLETYAEKVIEKVQPFAGHSYEGCRKTAISTLWRTYARVFQVWESSTGVKWQPGM
PPNPLPPPSIVSMADMLYKTTTTMWSEDSERRLTQTRNAVAEKTSVVTDINRNVAATLRACGPAVLAGGQEMLSE
VVSVVGSIITRSHPCQQDLGEEEEERDIDGGSSEYDWLVIDTAMDVVIGLAAALGASFGELWKIFDKPILKLVSS
SEELHRSTAVGTIAEVTKFAGEGISPYTESLGQALGRRLTDPDPLTKSNAAYAMGLLVLKSNETSKTVPLFPQLW
EKLEPLLTTKEVRTTDNVAGCLARMMMKHSDKDFVSQALPAVVDVLPLTEDYEENEPIFQCIYSLYERGNDTVER
LTPQLIGIFEKVLSPPEEQLEAETREVLRTTVQTIYKAKPELLSAHPGLLQLMGAH*
Coding >Ophun1|2650
ATGGATAAGGACAGGCTCGTGCAGCTGCTACAGGCCAGCCAAGTTCCCAACACTGAGCAGGTCAAGGCCGTGACG
GCAGACCTCCAGAAGAACTTCTACTCGCAGCCCGAGTCGCTTCTGCTGCTCATCGAAGTCACACTGACCCACGCA
GATGGCGCTCTTCGACAGCTCGCCGCCGTTCAGGCCCTCCGCCTCGTCAGCAAGCACTGGAAGCCGACGCCGGAG
GACAAGAAAGCCTTGGCCCGCTCTCACCTCCTCGACGGCACTCTCAAGGAAACGTCGCTGAGCATCCGTCACTCC
ATGGCCCGTCTCTTGGCCGGCATCGTCGGCATCGACCTGGAGCTCGGACAGGGCGACGACTTTCTCAAACAGCTG
CTGCCCCTCAACAACAGCGACAATGTCGTCGCCCGCGAAGTCGGCTCCTTCATCCTCTTCTCCATGCTCGAGGAT
GATCCCACCCATTTCAGTGGCTACATCCCTCAGCTGCTCCAGCTCTTCCGTTCCCGCATCAAGGATCCTGACAGT
AAGGAAGTGCAGATCAACATCGTCCAGGCCATCAGTGCCATGCTTCTCATCCTCGATCCCGAAGAGAATCCAGAG
GGCCTCGCCACCATGCAGAGCTTCATGCCGGATCTCGTCAACATTCTCAAGGTTGCCGTCGAGGTCGGTGACGAC
GAGGGCTACAGGACCGTCTTTGAAGTCTTCCATTCTTTTCTCGCCTACGACCCGGCCCTGCTGTCTGTCCATTTG
CACGACCTCTTGCAGTTCATGATTGATCTAGCCGCCAACGCAGATGCCGAGGAGGACGCCCGCACCCAGGCCCTC
GGCTTCCTCATCCAGTGTGTGCGCTACCGCCGCATGAAGATCCAAGGCATGAAGGACATGGGCGCCCAGCTCATG
GTCAAGGCCATGCAGATCGTTGGTTCGCTCGATGCCGACGACGATGATGAGGACCTGTCGCCCGCTCGCACCGCC
ATCAGTCTCATCAACACGCTGGCCAGCGAGCTACCTCCCCGTCAGGTCGTCGTACCGCTGCTCGACCAGTTCCCG
TCGTACGCGACCAGCTCTCACCCCGGCTTGCGTATGGCCTCCGTGCTGGCCCTCGGCAACGCCGCCGAGGGTGCC
CCCGACTTCGTCTCGACTCAGCTGCAGCCACTCTTGCCCACCATTTTGAACCTTCTCTGCGATTCCGACGGTCAA
GTCCGTCACGCCGCCCTCGTTGGTCTCATCCACCTAGCCGAGGAAATGGCCGACGAGATGGCCTCCAAGCACGAG
GAGATCATCTCTGCCGTTCTCAACAACCTCGAGGCCGCCGCCCAGGGCCCGTCGGATAAGCAAAAGGTCAGCATC
ATTCGCAGCGCCTGTGGTGCCTTAGATACCTTTGGCGACGGCGTCGACACCAAGATCATGGCCCAGTTCGGTCCC
AGCCTCATTGGGCCCATGGTCAAGCTCCTCGACCACGACGACTTTGGGGTCAAGGCTGCGGCTGCCTCTGCCATT
GGCGCCATTGCGTCGTCGATGGGCAACGCTTTCGAGCCCTACTTCAAGGGAGTCATGGAAGCCCTCGCCAAGTTT
GTCATGCTCAAGGACGACGACGATGCCATGAATTTGCGGAGCTCGACCTGCGACAGCCTGGGTCGCATCGCCATG
TCGGTCGGTGCCGATGCATTCCAGCCATACGTAATGGATCTCATGAAGGCGAGCGAAGAGGCCCTCTCCCTCGAC
AATCCAAGGCTCAAGGAGACGAGCTTCATCCTCTGGTCCAACCTGTCCAAGGTGTACCGCGAGCAGTTCAACCAT
TTCCTCGATGGTGTCTTCAAGGGCATCTTTGCCTCCCTCGAACTCGAGGAGACTGAGCTGGAGATCCCCGACGTC
GACCCTAGCCTGCTGGCCGACGGCGCCATCTTCGGTGGCAAGCGAGTCAAGCTAAAGTCGGCAGACGACATGGCC
ACGGCCATCGACGAAGGTGAATGGGACGACCTCGATAGCATGGAGGATCTCGGCGCCGTCACCGCCGTCGCCCTG
GAACAAGAGATAGCGCTCGAGGTTCTGGGCGATGTCGTCACCAACTGCTGCAACAGCGCCAACCTCGAGACGTAT
GCCGAAAAGGTCATCGAAAAGGTGCAACCCTTTGCCGGACACAGCTACGAGGGCTGCCGCAAGACGGCCATCTCC
ACCCTCTGGCGCACCTACGCCCGTGTCTTTCAGGTGTGGGAGAGCAGCACGGGCGTCAAGTGGCAGCCTGGCATG
CCCCCCAACCCGTTGCCCCCGCCGTCCATCGTCAGCATGGCAGACATGCTATACAAGACGACGACGACTATGTGG
AGCGAGGACAGTGAAAGGCGACTCACTCAGACGCGAAACGCGGTTGCTGAGAAAACGTCGGTCGTTACAGACATC
AATCGCAACGTCGCCGCCACACTGAGAGCCTGTGGTCCGGCTGTGCTGGCTGGAGGCCAGGAAATGCTATCAGAG
GTGGTTTCTGTCGTCGGCAGCATCATCACCCGGTCGCATCCCTGCCAGCAAGACTTGGGAGAGGAAGAAGAGGAG
CGTGATATCGACGGCGGATCGTCGGAATATGACTGGCTCGTCATCGATACCGCCATGGACGTGGTCATTGGTCTC
GCCGCGGCTCTGGGCGCTTCATTTGGCGAGCTGTGGAAGATCTTTGACAAGCCCATCCTGAAGCTGGTCAGCTCT
TCCGAGGAGCTGCACCGGTCCACGGCCGTCGGCACCATTGCCGAGGTGACCAAGTTTGCGGGCGAGGGCATCTCG
CCCTATACCGAGTCGCTGGGCCAAGCATTGGGCCGTCGTCTTACGGACCCCGACCCTCTTACCAAGTCGAACGCG
GCCTACGCCATGGGCCTCTTGGTCTTAAAGTCGAACGAGACCAGCAAGACTGTGCCCCTCTTCCCGCAGCTCTGG
GAGAAGCTGGAGCCGCTGCTGACGACAAAGGAGGTGCGCACGACGGACAACGTCGCTGGCTGCCTTGCGCGTATG
ATGATGAAGCACTCGGACAAGGACTTTGTCTCTCAAGCGCTCCCTGCCGTCGTCGACGTGCTCCCCCTGACGGAG
GACTACGAAGAGAACGAGCCCATCTTCCAGTGCATATACAGCCTCTACGAGCGAGGCAACGATACGGTCGAGCGA
CTGACGCCGCAGCTGATTGGCATCTTCGAAAAGGTCTTGAGTCCGCCCGAGGAGCAGCTGGAAGCGGAGACGCGC
GAGGTGCTGCGTACGACGGTGCAGACCATCTACAAGGCGAAGCCGGAGCTGCTGTCGGCTCATCCGGGGCTGCTG
CAGCTGATGGGTGCTCACTAG
Transcript >Ophun1|2650
ATGGATAAGGACAGGCTCGTGCAGCTGCTACAGGCCAGCCAAGTTCCCAACACTGAGCAGGTCAAGGCCGTGACG
GCAGACCTCCAGAAGAACTTCTACTCGCAGCCCGAGTCGCTTCTGCTGCTCATCGAAGTCACACTGACCCACGCA
GATGGCGCTCTTCGACAGCTCGCCGCCGTTCAGGCCCTCCGCCTCGTCAGCAAGCACTGGAAGCCGACGCCGGAG
GACAAGAAAGCCTTGGCCCGCTCTCACCTCCTCGACGGCACTCTCAAGGAAACGTCGCTGAGCATCCGTCACTCC
ATGGCCCGTCTCTTGGCCGGCATCGTCGGCATCGACCTGGAGCTCGGACAGGGCGACGACTTTCTCAAACAGCTG
CTGCCCCTCAACAACAGCGACAATGTCGTCGCCCGCGAAGTCGGCTCCTTCATCCTCTTCTCCATGCTCGAGGAT
GATCCCACCCATTTCAGTGGCTACATCCCTCAGCTGCTCCAGCTCTTCCGTTCCCGCATCAAGGATCCTGACAGT
AAGGAAGTGCAGATCAACATCGTCCAGGCCATCAGTGCCATGCTTCTCATCCTCGATCCCGAAGAGAATCCAGAG
GGCCTCGCCACCATGCAGAGCTTCATGCCGGATCTCGTCAACATTCTCAAGGTTGCCGTCGAGGTCGGTGACGAC
GAGGGCTACAGGACCGTCTTTGAAGTCTTCCATTCTTTTCTCGCCTACGACCCGGCCCTGCTGTCTGTCCATTTG
CACGACCTCTTGCAGTTCATGATTGATCTAGCCGCCAACGCAGATGCCGAGGAGGACGCCCGCACCCAGGCCCTC
GGCTTCCTCATCCAGTGTGTGCGCTACCGCCGCATGAAGATCCAAGGCATGAAGGACATGGGCGCCCAGCTCATG
GTCAAGGCCATGCAGATCGTTGGTTCGCTCGATGCCGACGACGATGATGAGGACCTGTCGCCCGCTCGCACCGCC
ATCAGTCTCATCAACACGCTGGCCAGCGAGCTACCTCCCCGTCAGGTCGTCGTACCGCTGCTCGACCAGTTCCCG
TCGTACGCGACCAGCTCTCACCCCGGCTTGCGTATGGCCTCCGTGCTGGCCCTCGGCAACGCCGCCGAGGGTGCC
CCCGACTTCGTCTCGACTCAGCTGCAGCCACTCTTGCCCACCATTTTGAACCTTCTCTGCGATTCCGACGGTCAA
GTCCGTCACGCCGCCCTCGTTGGTCTCATCCACCTAGCCGAGGAAATGGCCGACGAGATGGCCTCCAAGCACGAG
GAGATCATCTCTGCCGTTCTCAACAACCTCGAGGCCGCCGCCCAGGGCCCGTCGGATAAGCAAAAGGTCAGCATC
ATTCGCAGCGCCTGTGGTGCCTTAGATACCTTTGGCGACGGCGTCGACACCAAGATCATGGCCCAGTTCGGTCCC
AGCCTCATTGGGCCCATGGTCAAGCTCCTCGACCACGACGACTTTGGGGTCAAGGCTGCGGCTGCCTCTGCCATT
GGCGCCATTGCGTCGTCGATGGGCAACGCTTTCGAGCCCTACTTCAAGGGAGTCATGGAAGCCCTCGCCAAGTTT
GTCATGCTCAAGGACGACGACGATGCCATGAATTTGCGGAGCTCGACCTGCGACAGCCTGGGTCGCATCGCCATG
TCGGTCGGTGCCGATGCATTCCAGCCATACGTAATGGATCTCATGAAGGCGAGCGAAGAGGCCCTCTCCCTCGAC
AATCCAAGGCTCAAGGAGACGAGCTTCATCCTCTGGTCCAACCTGTCCAAGGTGTACCGCGAGCAGTTCAACCAT
TTCCTCGATGGTGTCTTCAAGGGCATCTTTGCCTCCCTCGAACTCGAGGAGACTGAGCTGGAGATCCCCGACGTC
GACCCTAGCCTGCTGGCCGACGGCGCCATCTTCGGTGGCAAGCGAGTCAAGCTAAAGTCGGCAGACGACATGGCC
ACGGCCATCGACGAAGGTGAATGGGACGACCTCGATAGCATGGAGGATCTCGGCGCCGTCACCGCCGTCGCCCTG
GAACAAGAGATAGCGCTCGAGGTTCTGGGCGATGTCGTCACCAACTGCTGCAACAGCGCCAACCTCGAGACGTAT
GCCGAAAAGGTCATCGAAAAGGTGCAACCCTTTGCCGGACACAGCTACGAGGGCTGCCGCAAGACGGCCATCTCC
ACCCTCTGGCGCACCTACGCCCGTGTCTTTCAGGTGTGGGAGAGCAGCACGGGCGTCAAGTGGCAGCCTGGCATG
CCCCCCAACCCGTTGCCCCCGCCGTCCATCGTCAGCATGGCAGACATGCTATACAAGACGACGACGACTATGTGG
AGCGAGGACAGTGAAAGGCGACTCACTCAGACGCGAAACGCGGTTGCTGAGAAAACGTCGGTCGTTACAGACATC
AATCGCAACGTCGCCGCCACACTGAGAGCCTGTGGTCCGGCTGTGCTGGCTGGAGGCCAGGAAATGCTATCAGAG
GTGGTTTCTGTCGTCGGCAGCATCATCACCCGGTCGCATCCCTGCCAGCAAGACTTGGGAGAGGAAGAAGAGGAG
CGTGATATCGACGGCGGATCGTCGGAATATGACTGGCTCGTCATCGATACCGCCATGGACGTGGTCATTGGTCTC
GCCGCGGCTCTGGGCGCTTCATTTGGCGAGCTGTGGAAGATCTTTGACAAGCCCATCCTGAAGCTGGTCAGCTCT
TCCGAGGAGCTGCACCGGTCCACGGCCGTCGGCACCATTGCCGAGGTGACCAAGTTTGCGGGCGAGGGCATCTCG
CCCTATACCGAGTCGCTGGGCCAAGCATTGGGCCGTCGTCTTACGGACCCCGACCCTCTTACCAAGTCGAACGCG
GCCTACGCCATGGGCCTCTTGGTCTTAAAGTCGAACGAGACCAGCAAGACTGTGCCCCTCTTCCCGCAGCTCTGG
GAGAAGCTGGAGCCGCTGCTGACGACAAAGGAGGTGCGCACGACGGACAACGTCGCTGGCTGCCTTGCGCGTATG
ATGATGAAGCACTCGGACAAGGACTTTGTCTCTCAAGCGCTCCCTGCCGTCGTCGACGTGCTCCCCCTGACGGAG
GACTACGAAGAGAACGAGCCCATCTTCCAGTGCATATACAGCCTCTACGAGCGAGGCAACGATACGGTCGAGCGA
CTGACGCCGCAGCTGATTGGCATCTTCGAAAAGGTCTTGAGTCCGCCCGAGGAGCAGCTGGAAGCGGAGACGCGC
GAGGTGCTGCGTACGACGGTGCAGACCATCTACAAGGCGAAGCCGGAGCTGCTGTCGGCTCATCCGGGGCTGCTG
CAGCTGATGGGTGCTCACTAG
Gene >Ophun1|2650
ATGGATAAGGACAGGCTCGTGCAGCTGCTACAGGCCAGCCAAGTTCGTGAGTCGCCGCTTCCCCCTTCCGCTATT
CCGTCTCTTGCCTGACCTGACCTATTCGTACTCTAGCCAACACTGAGCAGGTCAAGGCCGTGACGGCAGACCTCC
AGAAGAACTTCTACTCGCAGCCCGAGTCGCTTCTGCTGCTCATCGAAGTCACACTGACCCACGCAGATGGCGCTC
TTCGACAGCTCGCCGCCGTTCAGGCCCTCCGCCTCGTCAGCAAGCACTGGAAGCCGACGCCGGAGGACAAGAAAG
CCTTGGCCCGCTCTCACCTCCTCGACGGCACTCTCAAGGAAACGTCGCTGAGCATCCGTCACTCCATGGCCCGTC
TCTTGGCCGGCATCGTCGGCATCGACCTGGAGCTCGGACAGGGCGACGACTTTCTCAAACAGCTGCTGCCCCTCA
ACAACAGCGACAATGTCGTCGCCCGCGAAGTCGGCTCCTTCATCCTCTTCTCCATGCTCGAGGATGATCCCACCC
ATTTCAGTGGCTACATCCCTCAGCTGCTCCAGCTCTTCCGTTCCCGCATCAAGGATCCTGACAGTAAGGAAGTGC
AGATCAACATCGTCCAGGCCATCAGTGCCATGCTTCTCATCCTCGATCCCGAAGAGAATCCAGAGGGCCTCGCCA
CCATGCAGAGCTTCATGCCGGATCTCGTCAACATTCTCAAGGTTGCCGTCGAGGTCGGTGACGACGAGGGCTACA
GGACCGTCTTTGAAGTCTTCCATTCTTTTCTCGCCTACGACCCGGCCCTGCTGTCTGTCCATTTGCACGACCTCT
TGCAGTTCATGATTGATCTAGCCGCCAACGCAGATGCCGAGGAGGACGCCCGCACCCAGGCCCTCGGCTTCCTCA
TCCAGTGTGTGCGCTACCGCCGCATGAAGATCCAAGGCATGAAGGACATGGGCGCCCAGCTCATGGTCAAGGCCA
TGCAGATCGTTGGTTCGCTCGATGCCGACGACGATGATGAGGACCTGTCGCCCGCTCGCACCGCCATCAGTCTCA
TCAACACGCTGGCCAGCGAGCTACCTCCCCGTCAGGTCGTCGTACCGCTGCTCGACCAGTTCCCGTCGTACGCGA
CCAGCTCTCACCCCGGCTTGCGTATGGCCTCCGTGCTGGCCCTCGGCAACGCCGCCGAGGGTGCCCCCGACTTCG
TCTCGACTCAGCTGCAGCCACTCTTGCCCACCATTTTGAACCTTCTCTGCGATTCCGACGGTCAAGTCCGTCACG
CCGCCCTCGTTGGTCTCATCCACCTAGCCGAGGAAATGGCCGACGAGATGGCCTCCAAGCACGAGGAGATCATCT
CTGCCGTTCTCAACAACCTCGAGGCCGCCGCCCAGGGCCCGTCGGATAAGCAAAAGGTCAGCATCATTCGCAGCG
CCTGTGGTGCCTTAGATACCTTTGGCGACGGCGTCGACACCAAGATCATGGCCCAGTTCGGTCCCAGCCTCATTG
GGCCCATGGTCAAGCTCCTCGACCACGACGACTTTGGGGTCAAGGCTGCGGCTGCCTCTGCCATTGGCGCCATTG
CGTCGTCGATGGGCAACGCTTTCGAGCCCTACTTCAAGGGAGTCATGGAAGCCCTCGCCAAGTTTGTCATGCTCA
AGGACGACGACGATGCCATGAATTTGCGGAGCTCGACCTGCGACAGCCTGGGTCGCATCGCCATGTCGGTCGGTG
CCGATGCATTCCAGCCATACGTAATGGATCTCATGAAGGCGAGCGAAGAGGCCCTCTCCCTCGACAATCCAAGGC
TCAAGGAGACGAGCTTCATCCTCTGGTCCAACCTGTCCAAGGTGTACCGCGAGCAGTTCAACCATTTCCTCGATG
GTGTCTTCAAGGGCATCTTTGCCTCCCTCGAACTCGAGGAGACTGAGCTGGAGATCCCCGACGTCGACCCTAGCC
TGCTGGCCGACGGCGCCATCTTCGGTGGCAAGCGAGTCAAGCTAAAGTCGGCAGACGACATGGCCACGGCCATCG
ACGAAGGTGAATGGGACGACCTCGATAGCATGGAGGATCTCGGCGCCGTCACCGCCGTCGCCCTGGAACAAGAGA
TAGCGCTCGAGGTTCTGGGCGATGTCGTCACCAACTGCTGCAACAGCGCCAACCTCGAGACGTATGCCGAAAAGG
TCATCGAAAAGGTGCAACCCTTTGCCGGACACAGCTACGAGGGCTGCCGCAAGACGGCCATCTCCACCCTCTGGC
GCACCTACGCCCGTGTCTTTCAGGTGTGGGAGAGCAGCACGGGCGTCAAGTGGCAGCCTGGCATGCCCCCCAACC
CGTTGCCCCCGCCGTCCATCGTCAGCATGGCAGACATGCTATACAAGACGACGACGACTATGTGGAGCGAGGACA
GTGAAAGGCGAGTGATTGAGCGCTTTCTCCCTTCTTTCTCTTGCATGATGAGACGTTATCGTTATACCCAGCTCA
CTCAGACGCGAAACGCGGTTGCTGAGAAAACGTGATTTATCTAACTCCTGACTTTGCTTGCTTCGTTGACCTTCC
ATTGCCGCCTCGTGCCTTTTGACATAACCGACGCAATGCTGACGGATTTGCTATTCACAGGTCGGTCGTTACAGA
CATCAATCGCAACGTCGCCGCCACACTGAGAGCCTGTGGTCCGGCTGTGCTGGCTGGAGGCCAGGAAATGCTATC
AGAGGTGGTTTCTGTCGTCGGCAGCATCATCACCCGGTCGCATCCCTGCCAGCAAGACTTGGGAGAGGAAGAAGA
GGAGCGTGATATCGACGGCGGATCGTCGGAATATGACTGGCTCGTCATCGATACCGCCATGGACGTGGTCATTGG
TCTCGCCGCGGCTCTGGGCGCTTCATTTGGCGAGCTGTGGAAGATCTTTGACAAGCCCATCCTGAAGCTGGTCAG
CTCTTCCGAGGAGCTGCACCGGTCCACGGCCGTCGGCACCATTGCCGAGGTGACCAAGTTTGCGGGCGAGGGCAT
CTCGCCCTATACCGAGTCGCTGGGCCAAGCATTGGGCCGTCGTCTTACGGACCCCGACCCTCTTACCAAGTCGAA
CGCGGCCTACGCCATGGGCCTCTTGGTCTTAAAGTCGAACGAGACCAGCAAGACTGTGCCCCTCTTCCCGCAGCT
CTGGGAGAAGCTGGAGCCGCTGCTGACGACAAAGGAGGTGCGCACGACGGACAACGTCGCTGGCTGCCTTGCGCG
TATGATGATGAAGCACTCGGACAAGGACTTTGTCTCTCAAGCGCTCCCTGCCGTCGTCGACGTGCTCCCCCTGAC
GGAGGACTACGAAGAGAACGAGCCCATCTTCCAGTGCATATACAGCCTCTGTAAGTCTCGCCAGTTCTTTCTCGG
TTTGTTGTCTCGGGCTGACAGGGCAAATGGCAGACGAGCGAGGCAACGATACGGTCGAGCGACTGACGCCGCAGC
TGATTGGCATCTTCGAAAAGGTCTTGAGTCCGCCCGAGGAGCAGCTGGAAGCGGAGACGCGCGAGGTGCTGCGTA
CGACGGTGCAGACCATCTACAAGGCGAAGCCGGAGCTGCTGTCGGCTCATCCGGGGCTGCTGCAGCTGATGGGTG
CTCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail