Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2649
Gene name
LocationContig_237:10812..13539
Strand+
Gene length (bp)2727
Transcript length (bp)2727
Coding sequence length (bp)2727
Protein length (aa) 909

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05346 DUF747 Eukaryotic membrane protein family 4.9E-117 380 819

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 365 554 4.0E-51
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 374 555 4.0E-44
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 385 701 1.0E-41
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 385 551 1.0E-39
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 385 551 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 365 554 4.0E-51
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 374 555 4.0E-44
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 385 701 1.0E-41
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 385 551 1.0E-39
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 385 551 1.0E-39
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 327 551 1.0E-39
sp|Q4VBD2|TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus GN=Tapt1 PE=1 SV=2 385 551 3.0E-39
sp|Q6NXT6|TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1 385 551 4.0E-39
sp|A2BIE7|TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio GN=tapt1 PE=3 SV=1 385 551 7.0E-39
sp|Q9U3H8|TAPT1_CAEEL Protein TAPT1 homolog OS=Caenorhabditis elegans GN=F26F2.7 PE=3 SV=1 385 555 2.0E-36
sp|F4HVJ3|POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana GN=POD1 PE=1 SV=1 380 556 3.0E-27
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 629 827 2.0E-21
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 632 699 4.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 790 812 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3681
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|963
Ophiocordyceps australis map64 (Brazil) OphauB2|7283
Ophiocordyceps camponoti-floridani Ophcf2|01295
Ophiocordyceps camponoti-rufipedis Ophun1|2649 (this protein)
Ophiocordyceps kimflemingae Ophio5|5541
Ophiocordyceps subramaniannii Hirsu2|7118

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2649
MTDVVQPQAPADGSTGSASPPHKRRIKTNSADNIARLTAEEVRQLTSAPDSLPVAPAPKRRASDHEQSLDAGRRS
LLSPRTVSSPATPRVVAVGDVGPVPERRFSLASRPRPLSLDAGAMNGFAYGLAVQTAPSSPAIQQHHQEQQQQQQ
QQQQPTKPPPSTAEDDTQTASRQRQPSPAPAVIPLPPTSLPTHLQLELAAQRPSPLYIHASHSASMPYESNAVKL
ERLKNVVLLPAYLERTLYFGALACLDAWLHTFTILPIRFVLALAVLARWWGGVMGNEASWLVGFVWYGLGRLWAR
AGRSIKKTKTTTTTTTMTTESESTTTTTPPTRPGSGSKQQQQRRRKSARLPSASTTTSDPGPRTGSFRHRRTKSQ
PSNLSAFHKADLLQGAVIICSSAALMTLDASRMYHLVRAQSAIKLYVIFNILEVGDRLLSSLGQDILECLFSSET
LSRNASGRSKVFVPLAMFVLALAYNCLHSVALYYQVITLNVAVNSYSNALLTLLLSNQFVEIKSTVFKRFEREGL
FQLTCADIVERFHLWVMLLIIGMRNVVEVGGLSIPGAGAGDSSSFSSSSSFSSSHFSSSASSSSASASSSSSSSA
GTHNGPLHPASILPHSFTVLPSWLASGEVISPFLIVVGSEMLVDSIKHAYVTKFNNIKPAFYARTLDILCKDYYT
NAFTTPSLTRRLGLAVIPLSCLFIRASIQTYHMFLSTQIPMPIPIPRSTQTSLLVDEESATPSSPAMVAALSRLD
ALLRDSLGRATYGYPYGSPLNSRPWYSWTSDDFIAALTMVVVFFIAFLLLLALKLLLGMALLQYSRNRYAAMKRK
EHARAAGRAPPPDTYITAGRRAGTRPEVELSDDRLRWIKADPSEGPPDTGKRRGDAGGGGKRAVADDDFQGVSRF
DMVAKRIW*
Coding >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG
Transcript >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG
Gene >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail