Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2649
Gene name
LocationContig_237:10812..13539
Strand+
Gene length (bp)2727
Transcript length (bp)2727
Coding sequence length (bp)2727
Protein length (aa) 909

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05346 DUF747 Eukaryotic membrane protein family 4.9E-117 380 819

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 365 554 4.0E-51
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 374 555 4.0E-44
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 385 701 1.0E-41
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 385 551 1.0E-39
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 385 551 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 365 554 4.0E-51
sp|Q550C1|TAPT1_DICDI Protein TAPT1 homolog OS=Dictyostelium discoideum GN=DDB_G0277313 PE=3 SV=2 374 555 4.0E-44
sp|Q9VED0|TAPT1_DROME Protein TAPT1 homolog OS=Drosophila melanogaster GN=CG7218 PE=2 SV=2 385 701 1.0E-41
sp|Q5EAY8|TAPT1_XENLA Transmembrane anterior posterior transformation protein 1 homolog OS=Xenopus laevis GN=tapt1 PE=2 SV=1 385 551 1.0E-39
sp|Q5ZLG8|TAPT1_CHICK Transmembrane anterior posterior transformation protein 1 homolog OS=Gallus gallus GN=TAPT1 PE=2 SV=2 385 551 1.0E-39
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 327 551 1.0E-39
sp|Q4VBD2|TAPT1_MOUSE Transmembrane anterior posterior transformation protein 1 OS=Mus musculus GN=Tapt1 PE=1 SV=2 385 551 3.0E-39
sp|Q6NXT6|TAPT1_HUMAN Transmembrane anterior posterior transformation protein 1 homolog OS=Homo sapiens GN=TAPT1 PE=1 SV=1 385 551 4.0E-39
sp|A2BIE7|TAPT1_DANRE Transmembrane anterior posterior transformation protein 1 homolog OS=Danio rerio GN=tapt1 PE=3 SV=1 385 551 7.0E-39
sp|Q9U3H8|TAPT1_CAEEL Protein TAPT1 homolog OS=Caenorhabditis elegans GN=F26F2.7 PE=3 SV=1 385 555 2.0E-36
sp|F4HVJ3|POD1_ARATH Protein POLLEN DEFECTIVE IN GUIDANCE 1 OS=Arabidopsis thaliana GN=POD1 PE=1 SV=1 380 556 3.0E-27
sp|O60067|TAPT1_SCHPO Endoplasmic reticulum membrane protein 65 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.05 PE=1 SV=1 629 827 2.0E-21
sp|P40085|TAPT1_YEAST Endoplasmic reticulum membrane protein 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP65 PE=1 SV=1 632 699 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 790 812 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2649
MTDVVQPQAPADGSTGSASPPHKRRIKTNSADNIARLTAEEVRQLTSAPDSLPVAPAPKRRASDHEQSLDAGRRS
LLSPRTVSSPATPRVVAVGDVGPVPERRFSLASRPRPLSLDAGAMNGFAYGLAVQTAPSSPAIQQHHQEQQQQQQ
QQQQPTKPPPSTAEDDTQTASRQRQPSPAPAVIPLPPTSLPTHLQLELAAQRPSPLYIHASHSASMPYESNAVKL
ERLKNVVLLPAYLERTLYFGALACLDAWLHTFTILPIRFVLALAVLARWWGGVMGNEASWLVGFVWYGLGRLWAR
AGRSIKKTKTTTTTTTMTTESESTTTTTPPTRPGSGSKQQQQRRRKSARLPSASTTTSDPGPRTGSFRHRRTKSQ
PSNLSAFHKADLLQGAVIICSSAALMTLDASRMYHLVRAQSAIKLYVIFNILEVGDRLLSSLGQDILECLFSSET
LSRNASGRSKVFVPLAMFVLALAYNCLHSVALYYQVITLNVAVNSYSNALLTLLLSNQFVEIKSTVFKRFEREGL
FQLTCADIVERFHLWVMLLIIGMRNVVEVGGLSIPGAGAGDSSSFSSSSSFSSSHFSSSASSSSASASSSSSSSA
GTHNGPLHPASILPHSFTVLPSWLASGEVISPFLIVVGSEMLVDSIKHAYVTKFNNIKPAFYARTLDILCKDYYT
NAFTTPSLTRRLGLAVIPLSCLFIRASIQTYHMFLSTQIPMPIPIPRSTQTSLLVDEESATPSSPAMVAALSRLD
ALLRDSLGRATYGYPYGSPLNSRPWYSWTSDDFIAALTMVVVFFIAFLLLLALKLLLGMALLQYSRNRYAAMKRK
EHARAAGRAPPPDTYITAGRRAGTRPEVELSDDRLRWIKADPSEGPPDTGKRRGDAGGGGKRAVADDDFQGVSRF
DMVAKRIW*
Coding >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG
Transcript >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG
Gene >Ophun1|2649
ATGACAGACGTCGTCCAGCCGCAGGCCCCCGCCGACGGCAGCACCGGATCAGCGTCACCCCCTCACAAGCGACGC
ATCAAGACAAACAGCGCCGACAACATCGCCCGTCTGACGGCCGAAGAGGTGCGCCAGTTGACGAGCGCGCCCGAC
TCGCTGCCCGTCGCGCCGGCGCCGAAAAGAAGGGCTTCGGACCATGAGCAGTCGCTGGATGCTGGCCGTCGGTCG
CTGCTTTCGCCGCGGACCGTGTCTTCGCCTGCGACGCCGCGCGTTGTTGCTGTCGGGGATGTTGGACCCGTTCCT
GAGAGGCGGTTTTCGTTGGCGTCGAGGCCGAGGCCGCTTAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGACTGGCTGTTCAGACGGCGCCTTCGAGTCCTGCGATTCAGCAGCATCATCAAGAGCAGCAGCAACAGCAACAA
CAGCAGCAGCAACCTACAAAACCACCGCCATCAACGGCTGAAGACGACACACAAACGGCTTCCCGTCAAAGACAG
CCATCACCAGCCCCAGCCGTGATCCCCCTCCCGCCCACCTCGCTCCCAACACACCTACAACTCGAACTGGCAGCC
CAGCGACCAAGCCCGCTGTACATCCACGCCTCGCACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTG
GAGCGGCTCAAGAACGTGGTGCTGCTGCCGGCCTACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTC
GACGCCTGGCTGCACACCTTTACCATCCTGCCGATCCGCTTCGTGCTCGCGCTCGCCGTCTTGGCTCGTTGGTGG
GGGGGGGTCATGGGGAATGAGGCTTCCTGGCTTGTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGG
GCTGGGAGGAGCATCAAGAAGACCAAGACGACGACGACGACGACGACGATGACAACCGAGTCCGAGTCAACAACG
ACCACAACACCGCCCACCCGCCCCGGATCGGGCTCCAAACAACAGCAGCAACGACGCCGGAAATCAGCCCGCCTC
CCCTCCGCATCGACCACCACCTCCGACCCCGGCCCCCGAACCGGAAGCTTCCGCCACCGCCGCACAAAGTCCCAG
CCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTCATCATCTGCAGCTCAGCCGCCCTC
ATGACCCTCGACGCCAGCAGGATGTACCACCTCGTGCGCGCCCAGTCCGCCATAAAGCTCTACGTCATCTTCAAC
ATCCTCGAGGTCGGCGACCGGCTCCTCTCCTCGCTCGGTCAGGACATCCTCGAATGCCTCTTCAGCTCCGAGACG
CTCTCGCGCAACGCCTCGGGTCGGTCCAAGGTGTTTGTCCCGCTGGCCATGTTCGTGCTCGCCCTGGCCTACAAC
TGCCTACATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCCGTCAACTCGTACTCCAACGCCCTC
TTGACCCTCCTCCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTCAAGCGCTTCGAGAGGGAGGGCCTC
TTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATGCTCCTCATCATCGGCATGCGCAAC
GTCGTCGAGGTCGGCGGCTTATCCATCCCCGGTGCCGGCGCCGGCGACTCCTCCTCCTTTTCCTCCTCCTCTTCC
TTCTCCTCGTCCCACTTCTCCTCCTCGGCCTCCTCTTCCTCGGCCTCGGCCTCCTCCTCCTCCTCCTCCTCGGCC
GGCACCCACAACGGCCCCCTCCACCCAGCCTCCATCCTCCCTCACAGCTTCACCGTCTTACCCTCTTGGCTCGCC
TCCGGAGAGGTCATCTCGCCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTAC
GTCACCAAATTCAACAACATCAAACCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACA
AACGCCTTCACCACCCCGTCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCCTGCCTCTTCATCCGC
GCCTCCATCCAGACCTACCACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCCCGCTCAACCCAA
ACCTCCCTCCTCGTCGACGAAGAATCCGCAACTCCCTCCTCCCCCGCCATGGTCGCCGCCCTCAGCCGTCTCGAC
GCCCTCCTCCGCGACTCCCTCGGCCGCGCAACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGG
TACTCGTGGACATCAGACGACTTCATCGCCGCCCTGACAATGGTCGTCGTCTTCTTCATCGCCTTCCTCCTCCTC
CTAGCCCTCAAACTCCTCCTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAG
GAGCACGCCCGCGCCGCCGGCCGCGCCCCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGCACCCGC
CCAGAGGTGGAACTCTCGGACGATCGCCTCCGCTGGATCAAGGCCGATCCGTCAGAGGGTCCGCCCGATACGGGC
AAGAGGCGTGGCGACGCGGGGGGGGGGGGCAAGAGGGCCGTCGCTGACGATGATTTCCAGGGCGTTTCTCGCTTT
GACATGGTGGCCAAACGCATCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail