Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2642
Gene name
LocationContig_236:22855..24152
Strand+
Gene length (bp)1297
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 39 58 19
3 94 116 22
4 131 153 22
5 180 202 22
6 212 231 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2642
MAAVEAWVYLGICTALVLLRLYARLHSQAGGGVLHLDDHLMALAIPLFVAVVIVAQVIQSETQNLANNDMTPEYR
ASLDPLSDEFAMRVRGSQLHMAGWTIYVTLLWTLKICWLLLYRRFGERVSHIKLKINLGVVIVASTYLLVIFVVM
FACRPIGRNWQISPDPGDSCHPAVSKVQAIITALVNLGTDMYIIWIPLPIILGARISKLDKTILGTMFVACLVIT
MSVGLARCGLILTNSSGNTEFVGRWSYREAFVAVVISNMPVLFPWTRQKLSRHTKQKDSDAIPEPLRSLSIGSDQ
TIVVAGGLDSVKADLESGLRHKHHPEGGFDDDDDDDVSPLDARLQEGEAEEGRKGDGHGVVDKGETEERETLPPA
*
Coding >Ophun1|2642
ATGGCGGCTGTGGAGGCGTGGGTTTATCTGGGCATCTGCACGGCGCTGGTGCTGTTGCGGCTGTATGCCAGGCTT
CATTCGCAGGCTGGTGGAGGGGTTTTACATCTTGACGACCACTTGATGGCGCTGGCTATTCCGCTGTTTGTGGCC
GTCGTTATTGTGGCGCAGGTGATTCAATCGGAGACGCAAAACCTAGCCAACAACGACATGACACCCGAGTACCGA
GCCTCACTCGACCCCCTGAGTGACGAATTCGCCATGCGTGTCCGCGGCTCTCAACTACACATGGCCGGCTGGACC
ATCTACGTGACGCTCCTCTGGACGCTCAAGATCTGCTGGCTGCTTCTATACCGACGCTTCGGCGAGCGCGTCAGC
CACATCAAGCTCAAGATCAACCTCGGCGTCGTCATCGTGGCATCGACGTACCTGCTCGTCATCTTTGTCGTCATG
TTTGCCTGTCGACCCATTGGCCGGAACTGGCAGATTAGTCCGGATCCCGGCGATTCCTGTCATCCGGCTGTCTCC
AAGGTGCAGGCTATCATCACGGCCTTGGTCAATCTGGGGACCGACATGTATATCATCTGGATTCCGCTTCCTATC
ATCTTGGGCGCCCGCATCTCCAAACTCGACAAGACGATCCTCGGCACCATGTTCGTGGCCTGCCTCGTGATAACC
ATGTCCGTCGGCCTCGCCCGCTGCGGCCTCATCCTCACCAACTCATCCGGAAACACCGAGTTTGTCGGCCGCTGG
TCATACCGCGAGGCCTTTGTCGCCGTCGTCATCTCCAACATGCCCGTCCTCTTCCCCTGGACGCGCCAGAAGCTA
TCCCGACACACCAAGCAGAAAGATTCGGATGCGATTCCCGAGCCGTTGCGGTCGCTGAGCATCGGCTCCGATCAG
ACCATTGTCGTGGCTGGCGGTCTTGATTCCGTAAAGGCGGATCTGGAGTCTGGGCTGCGGCATAAGCATCATCCC
GAGGGGGGTTTTGATGATGATGATGATGATGATGTTTCACCTCTTGATGCTCGGTTACAGGAGGGTGAGGCGGAA
GAGGGGAGGAAGGGAGATGGCCATGGCGTCGTCGATAAGGGTGAGACGGAGGAGCGCGAGACGCTGCCGCCGGCA
TGA
Transcript >Ophun1|2642
ATGGCGGCTGTGGAGGCGTGGGTTTATCTGGGCATCTGCACGGCGCTGGTGCTGTTGCGGCTGTATGCCAGGCTT
CATTCGCAGGCTGGTGGAGGGGTTTTACATCTTGACGACCACTTGATGGCGCTGGCTATTCCGCTGTTTGTGGCC
GTCGTTATTGTGGCGCAGGTGATTCAATCGGAGACGCAAAACCTAGCCAACAACGACATGACACCCGAGTACCGA
GCCTCACTCGACCCCCTGAGTGACGAATTCGCCATGCGTGTCCGCGGCTCTCAACTACACATGGCCGGCTGGACC
ATCTACGTGACGCTCCTCTGGACGCTCAAGATCTGCTGGCTGCTTCTATACCGACGCTTCGGCGAGCGCGTCAGC
CACATCAAGCTCAAGATCAACCTCGGCGTCGTCATCGTGGCATCGACGTACCTGCTCGTCATCTTTGTCGTCATG
TTTGCCTGTCGACCCATTGGCCGGAACTGGCAGATTAGTCCGGATCCCGGCGATTCCTGTCATCCGGCTGTCTCC
AAGGTGCAGGCTATCATCACGGCCTTGGTCAATCTGGGGACCGACATGTATATCATCTGGATTCCGCTTCCTATC
ATCTTGGGCGCCCGCATCTCCAAACTCGACAAGACGATCCTCGGCACCATGTTCGTGGCCTGCCTCGTGATAACC
ATGTCCGTCGGCCTCGCCCGCTGCGGCCTCATCCTCACCAACTCATCCGGAAACACCGAGTTTGTCGGCCGCTGG
TCATACCGCGAGGCCTTTGTCGCCGTCGTCATCTCCAACATGCCCGTCCTCTTCCCCTGGACGCGCCAGAAGCTA
TCCCGACACACCAAGCAGAAAGATTCGGATGCGATTCCCGAGCCGTTGCGGTCGCTGAGCATCGGCTCCGATCAG
ACCATTGTCGTGGCTGGCGGTCTTGATTCCGTAAAGGCGGATCTGGAGTCTGGGCTGCGGCATAAGCATCATCCC
GAGGGGGGTTTTGATGATGATGATGATGATGATGTTTCACCTCTTGATGCTCGGTTACAGGAGGGTGAGGCGGAA
GAGGGGAGGAAGGGAGATGGCCATGGCGTCGTCGATAAGGGTGAGACGGAGGAGCGCGAGACGCTGCCGCCGGCA
TGA
Gene >Ophun1|2642
ATGGCGGCTGTGGAGGCGTGGGTTTATCTGGGCATCTGCACGGCGCTGGTGCTGTTGCGGCTGTATGCCAGGCTT
CATTCGCAGGCTGGTGGAGGGGTTTTACATCTTGACGACCACTTGATGGCGCTGGCTATTGTGAGTTTCTGGAGT
CTGTCGAGATGTTGAGTCTGGGTTGCTGATGCTGGTGATAGCCGCTGTTTGTGGCCGTCGTTATTGTGGCGCAGG
TGATTCAATCGGAGACGCAAAACCTAGCCAACAACGAGTGAGTCCCTGTGAAGGCATCATGATCTCTCGATATCC
CCTTCTGACCGGATAACAACAGCATGACACCCGAGTACCGAGCCTCACTCGACCCCCTGAGTGACGAATTCGCCA
TGCGTGTCCGCGGCTCTCAACTACACATGGCCGGCTGGACCATCTACGTGACGCTCCTCTGGACGCTCAAGATCT
GCTGGCTGCTTCTATACCGACGCTTCGGCGAGCGCGTCAGCCACATCAAGCTCAAGATCAACCTCGGCGTCGTCA
TCGTGGCATCGACGTACCTGCTCGTCATCTTTGTCGTCATGTTTGCCTGTCGACCCATTGGCCGGAACTGGCAGA
TTAGTCCGGATCCCGGCGATTCCTGTCATCCGGCTGTCTCCAAGGTGCAGGCTATCATCACGGCCTTGGTCAATC
TGGGGACCGACATGTATATCATCTGGATTCCGCTTCCTGTGAGTTCTCTTGCTCTCTGTTTCTCAACTCGAGGCT
GACATCAGACACCAAGATCATCTTGGGCGCCCGCATCTCCAAACTCGACAAGACGATCCTCGGCACCATGTTCGT
GGCCTGCCTCGTGATAACCATGTCCGTCGGCCTCGCCCGCTGCGGCCTCATCCTCACCAACTCATCCGGAAACAC
CGAGTTTGTCGGCCGCTGGTCATACCGCGAGGCCTTTGTCGCCGTCGTCATCTCCAACATGCCCGTCCTCTTCCC
CTGGACGCGCCAGAAGCTATCCCGACACACCAAGCAGAAAGATTCGGATGCGATTCCCGAGCCGTTGCGGTCGCT
GAGCATCGGCTCCGATCAGACCATTGTCGTGGCTGGCGGTCTTGATTCCGTAAAGGCGGATCTGGAGTCTGGGCT
GCGGCATAAGCATCATCCCGAGGGGGGTTTTGATGATGATGATGATGATGATGTTTCACCTCTTGATGCTCGGTT
ACAGGAGGGTGAGGCGGAAGAGGGGAGGAAGGGAGATGGCCATGGCGTCGTCGATAAGGGTGAGACGGAGGAGCG
CGAGACGCTGCCGCCGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail