Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2629
Gene name
LocationContig_235:19059..20988
Strand-
Gene length (bp)1929
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08159 NUC153 NUC153 domain 1.1E-10 495 523
PF00400 WD40 WD domain, G-beta repeat 1.5E-02 239 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74879|NOL10_SCHPO Ribosome biogenesis protein enp2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=enp2 PE=1 SV=1 1 640 1.0E-160
sp|P48234|NOL10_YEAST Ribosome biogenesis protein ENP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENP2 PE=1 SV=2 1 549 8.0E-160
sp|Q7T0Q5|NOL10_XENLA Nucleolar protein 10 OS=Xenopus laevis GN=nol10 PE=2 SV=1 1 521 3.0E-128
sp|Q802W4|NOL10_DANRE Nucleolar protein 10 OS=Danio rerio GN=nol10 PE=2 SV=1 1 530 1.0E-127
sp|Q66H99|NOL10_RAT Nucleolar protein 10 OS=Rattus norvegicus GN=Nol10 PE=2 SV=1 1 521 8.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74879|NOL10_SCHPO Ribosome biogenesis protein enp2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=enp2 PE=1 SV=1 1 640 1.0E-160
sp|P48234|NOL10_YEAST Ribosome biogenesis protein ENP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENP2 PE=1 SV=2 1 549 8.0E-160
sp|Q7T0Q5|NOL10_XENLA Nucleolar protein 10 OS=Xenopus laevis GN=nol10 PE=2 SV=1 1 521 3.0E-128
sp|Q802W4|NOL10_DANRE Nucleolar protein 10 OS=Danio rerio GN=nol10 PE=2 SV=1 1 530 1.0E-127
sp|Q66H99|NOL10_RAT Nucleolar protein 10 OS=Rattus norvegicus GN=Nol10 PE=2 SV=1 1 521 8.0E-127
sp|Q9BSC4|NOL10_HUMAN Nucleolar protein 10 OS=Homo sapiens GN=NOL10 PE=1 SV=1 1 521 9.0E-127
sp|Q6NVM6|NOL10_XENTR Nucleolar protein 10 OS=Xenopus tropicalis GN=nol10 PE=2 SV=1 1 521 4.0E-126
sp|Q5RJG1|NOL10_MOUSE Nucleolar protein 10 OS=Mus musculus GN=Nol10 PE=2 SV=1 1 521 5.0E-126
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 217 328 3.0E-08
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 217 328 3.0E-08
sp|Q94BR4|PR19A_ARATH Pre-mRNA-processing factor 19 homolog 1 OS=Arabidopsis thaliana GN=PRP19A PE=1 SV=1 216 314 7.0E-08
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 202 324 4.0E-07
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 197 324 9.0E-07
sp|P36408|GBB_DICDI Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 202 284 1.0E-06
sp|P49177|GBB_ARATH Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 207 322 1.0E-06
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 197 324 1.0E-06
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 201 324 2.0E-06
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 170 324 2.0E-06
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 217 324 2.0E-06
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 217 324 2.0E-06
sp|O22785|PR19B_ARATH Pre-mRNA-processing factor 19 homolog 2 OS=Arabidopsis thaliana GN=PRP19B PE=1 SV=3 189 275 2.0E-06
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 197 324 7.0E-06
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 204 274 8.0E-06
sp|P93398|GBB2_TOBAC Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1 204 274 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005515 protein binding Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2340
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6212
Ophiocordyceps australis map64 (Brazil) OphauB2|7086
Ophiocordyceps camponoti-floridani Ophcf2|01199
Ophiocordyceps camponoti-rufipedis Ophun1|2629 (this protein)
Ophiocordyceps kimflemingae Ophio5|693
Ophiocordyceps subramaniannii Hirsu2|3213

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2629
MKLTNPGVVSVYTVSGASTARPLPDWLARRRKRSLKNDVEYQNRVELLQDFEFEEASTCIRASEDGEWLMSTGTY
KPQIHVHNLPQLSLSFSRHTTSLNHSFVLLSHDYSKSIHLQTDRRLEFHTPMGCHYQVRIPRYGRDLAYDRNATE
ALVPAVGLDAEGRGEVFRMNLELGRFMKSYQVDVGGQGDEPGGGLQGSVSVGSVNVVAIAEDTHNLLAFGTSIGT
VEFWDPRSKSRAAVLAGHDGELTSLNFGPSGLSLATGSSNGMIRLFDLRRPVPLLEKDHGYGFPVQKLIHMTNSS
QEKKIMSADKRIIKLWDELTGDPWTSIEPVVDINDVAWCKNTGMLLTANEGKQQHAFFVPQLGPAPKWCSFLDNM
VEEMAEDVKAETYDNYKFLTLPELKQLSLSHLVGKTNLLRPYMHGYFVASKLYEQAKLIANPYAWEEDRMKRVKE
KVEKERASRIRGSKKVKVNQKLADRLLKKQENRNKVDPNAGLLGDERFAQLFEDEEFVVDENSREFQLRNPSTVV
SQPADAGAPTRYQAKDSEDESSDDDGGPTSTSRRKEELVMQVSSSREDKVKTRDTALGSRQQKPDRGNRAQRGDV
VGERQVTFVPQSKKKAAEAPPPRKALSGRRSASSNTFRRMER*
Coding >Ophun1|2629
ATGAAGCTGACAAACCCAGGCGTCGTCTCAGTCTACACTGTCTCTGGAGCCTCGACCGCGCGCCCTCTTCCCGAC
TGGCTCGCCCGTCGCAGAAAGCGCAGCCTCAAGAACGATGTCGAGTATCAGAACCGTGTCGAGTTGCTGCAGGAC
TTCGAGTTCGAGGAAGCCAGCACCTGCATCCGCGCCAGCGAGGATGGCGAATGGCTTATGAGTACCGGAACTTAC
AAGCCTCAAATCCATGTCCATAACCTCCCCCAGCTGTCCTTGTCCTTCAGCCGGCACACGACCTCGTTGAATCAC
TCCTTCGTCCTCCTCTCGCACGACTACTCCAAATCGATCCATCTCCAGACTGACCGGAGACTGGAGTTTCATACC
CCCATGGGATGCCACTACCAGGTCCGCATTCCCAGATATGGTCGCGATCTGGCTTATGACCGCAACGCTACCGAG
GCGCTGGTTCCTGCAGTCGGTCTCGATGCCGAGGGCAGGGGCGAGGTATTCCGCATGAATCTGGAACTGGGGCGA
TTCATGAAATCCTATCAGGTCGACGTTGGCGGCCAAGGCGACGAACCTGGGGGTGGCCTGCAAGGAAGCGTCAGC
GTTGGCAGCGTCAACGTCGTCGCCATCGCTGAGGACACTCACAACTTACTGGCCTTTGGAACATCGATAGGGACC
GTCGAATTTTGGGATCCGCGCTCCAAGTCCAGGGCCGCTGTGCTCGCCGGTCACGACGGCGAGCTGACCTCTCTG
AACTTCGGCCCTTCTGGCTTGTCCCTCGCGACCGGCTCCTCCAACGGCATGATTCGATTGTTTGATCTGCGACGT
CCGGTGCCTCTGCTGGAAAAGGATCACGGCTACGGCTTTCCAGTACAGAAGCTCATCCATATGACCAACTCGTCC
CAAGAAAAGAAAATCATGTCCGCGGACAAGCGTATCATCAAGCTTTGGGACGAGCTTACCGGTGATCCATGGACG
TCAATCGAGCCGGTGGTCGACATCAACGACGTGGCTTGGTGCAAAAATACCGGCATGCTCCTGACGGCCAACGAG
GGCAAGCAGCAACACGCCTTTTTCGTCCCACAACTTGGACCAGCCCCAAAGTGGTGCTCCTTCCTCGACAACATG
GTCGAAGAGATGGCCGAAGATGTCAAGGCCGAGACCTACGACAACTACAAGTTCCTGACGCTTCCGGAACTGAAG
CAGCTGAGCCTGTCACACTTGGTGGGCAAAACCAACCTACTCCGGCCCTACATGCACGGATACTTTGTCGCATCC
AAACTGTACGAGCAGGCCAAGCTCATCGCCAATCCGTACGCATGGGAGGAGGACAGGATGAAGCGCGTCAAGGAA
AAGGTCGAAAAGGAACGAGCCAGCAGGATCAGGGGCAGCAAGAAGGTCAAGGTCAATCAGAAGCTGGCCGACCGG
CTCCTCAAGAAGCAAGAGAACCGGAACAAGGTGGATCCCAACGCTGGTCTTCTCGGAGACGAACGTTTCGCCCAG
CTTTTCGAGGACGAGGAGTTTGTTGTGGACGAGAACAGCCGGGAGTTCCAACTTCGCAATCCAAGCACAGTCGTC
AGCCAACCCGCTGATGCTGGGGCTCCCACCCGTTATCAGGCCAAGGACTCTGAGGACGAGTCAAGCGATGACGAC
GGTGGGCCCACGTCGACGAGTCGCCGCAAGGAAGAACTGGTCATGCAGGTGTCCTCGTCCCGCGAAGACAAGGTC
AAAACTCGCGACACTGCATTGGGCTCCAGGCAGCAGAAGCCGGATCGCGGAAACAGGGCACAACGGGGCGACGTG
GTAGGAGAACGACAAGTTACATTTGTTCCCCAGTCGAAGAAGAAGGCGGCGGAAGCTCCTCCTCCAAGGAAAGCA
CTCAGTGGCCGACGCAGCGCAAGCTCCAACACGTTCCGGCGGATGGAGAGGTGA
Transcript >Ophun1|2629
ATGAAGCTGACAAACCCAGGCGTCGTCTCAGTCTACACTGTCTCTGGAGCCTCGACCGCGCGCCCTCTTCCCGAC
TGGCTCGCCCGTCGCAGAAAGCGCAGCCTCAAGAACGATGTCGAGTATCAGAACCGTGTCGAGTTGCTGCAGGAC
TTCGAGTTCGAGGAAGCCAGCACCTGCATCCGCGCCAGCGAGGATGGCGAATGGCTTATGAGTACCGGAACTTAC
AAGCCTCAAATCCATGTCCATAACCTCCCCCAGCTGTCCTTGTCCTTCAGCCGGCACACGACCTCGTTGAATCAC
TCCTTCGTCCTCCTCTCGCACGACTACTCCAAATCGATCCATCTCCAGACTGACCGGAGACTGGAGTTTCATACC
CCCATGGGATGCCACTACCAGGTCCGCATTCCCAGATATGGTCGCGATCTGGCTTATGACCGCAACGCTACCGAG
GCGCTGGTTCCTGCAGTCGGTCTCGATGCCGAGGGCAGGGGCGAGGTATTCCGCATGAATCTGGAACTGGGGCGA
TTCATGAAATCCTATCAGGTCGACGTTGGCGGCCAAGGCGACGAACCTGGGGGTGGCCTGCAAGGAAGCGTCAGC
GTTGGCAGCGTCAACGTCGTCGCCATCGCTGAGGACACTCACAACTTACTGGCCTTTGGAACATCGATAGGGACC
GTCGAATTTTGGGATCCGCGCTCCAAGTCCAGGGCCGCTGTGCTCGCCGGTCACGACGGCGAGCTGACCTCTCTG
AACTTCGGCCCTTCTGGCTTGTCCCTCGCGACCGGCTCCTCCAACGGCATGATTCGATTGTTTGATCTGCGACGT
CCGGTGCCTCTGCTGGAAAAGGATCACGGCTACGGCTTTCCAGTACAGAAGCTCATCCATATGACCAACTCGTCC
CAAGAAAAGAAAATCATGTCCGCGGACAAGCGTATCATCAAGCTTTGGGACGAGCTTACCGGTGATCCATGGACG
TCAATCGAGCCGGTGGTCGACATCAACGACGTGGCTTGGTGCAAAAATACCGGCATGCTCCTGACGGCCAACGAG
GGCAAGCAGCAACACGCCTTTTTCGTCCCACAACTTGGACCAGCCCCAAAGTGGTGCTCCTTCCTCGACAACATG
GTCGAAGAGATGGCCGAAGATGTCAAGGCCGAGACCTACGACAACTACAAGTTCCTGACGCTTCCGGAACTGAAG
CAGCTGAGCCTGTCACACTTGGTGGGCAAAACCAACCTACTCCGGCCCTACATGCACGGATACTTTGTCGCATCC
AAACTGTACGAGCAGGCCAAGCTCATCGCCAATCCGTACGCATGGGAGGAGGACAGGATGAAGCGCGTCAAGGAA
AAGGTCGAAAAGGAACGAGCCAGCAGGATCAGGGGCAGCAAGAAGGTCAAGGTCAATCAGAAGCTGGCCGACCGG
CTCCTCAAGAAGCAAGAGAACCGGAACAAGGTGGATCCCAACGCTGGTCTTCTCGGAGACGAACGTTTCGCCCAG
CTTTTCGAGGACGAGGAGTTTGTTGTGGACGAGAACAGCCGGGAGTTCCAACTTCGCAATCCAAGCACAGTCGTC
AGCCAACCCGCTGATGCTGGGGCTCCCACCCGTTATCAGGCCAAGGACTCTGAGGACGAGTCAAGCGATGACGAC
GGTGGGCCCACGTCGACGAGTCGCCGCAAGGAAGAACTGGTCATGCAGGTGTCCTCGTCCCGCGAAGACAAGGTC
AAAACTCGCGACACTGCATTGGGCTCCAGGCAGCAGAAGCCGGATCGCGGAAACAGGGCACAACGGGGCGACGTG
GTAGGAGAACGACAAGTTACATTTGTTCCCCAGTCGAAGAAGAAGGCGGCGGAAGCTCCTCCTCCAAGGAAAGCA
CTCAGTGGCCGACGCAGCGCAAGCTCCAACACGTTCCGGCGGATGGAGAGGTGA
Gene >Ophun1|2629
ATGAAGCTGACAAACCCAGGCGTCGTCTCAGTCTACACTGTCTCTGGAGCCTCGACCGCGCGCCCTCTTCCCGAC
TGGCTCGCCCGTCGCAGAAAGCGCAGCCTCAAGAACGATGTCGAGTATCAGAACCGTGTCGAGTTGCTGCAGGAC
TTCGAGTTCGAGGAAGCCAGCACCTGCATCCGCGCCAGCGAGGATGGCGAATGGCTTATGAGTACCGGAACTTAC
AAGCCTCAAATCCATGTCCATAACCTCCCCCAGCTGTCCTTGTCCTTCAGCCGGCACACGACCTCGTTGAATCAC
TCCTTCGTCCTCCTCTCGCACGACTACTCCAAATCGATCCATCTCCAGACTGACCGGAGACTGGAGTTTCATACC
CCCATGGGATGCCACTACCAGGTCCGCATTCCCAGATATGGTCGCGATCTGGCTTATGACCGCAACGCTACCGAG
GCGCTGGTTCCTGCAGTCGGTCTCGATGCCGAGGGCAGGGGCGAGGTATTCCGCATGAATCTGGAACTGGGGCGA
TTCATGAAATCCTATCAGGTCGACGTTGGCGGCCAAGGCGACGAACCTGGGGGTGGCCTGCAAGGAAGCGTCAGC
GTTGGCAGCGTCAACGTCGTCGCCATCGCTGAGGACACTCACAACTTACTGGCCTTTGGAACATCGATAGGGACC
GTCGAATTTTGGGATCCGCGCTCCAAGTCCAGGGCCGCTGTGCTCGCCGGTCACGACGGCGAGCTGACCTCTCTG
AACTTCGGCCCTTCTGGCTTGTCCCTCGCGACCGGCTCCTCCAACGGCATGATTCGATTGTTTGATCTGCGACGT
CCGGTGCCTCTGCTGGAAAAGGATCACGGCTACGGCTTTCCAGTACAGAAGCTCATCCATATGACCAACTCGTCC
CAAGAAAAGAAAATCATGTCCGCGGACAAGCGTATCATCAAGCTTTGGGACGAGCTTACCGGTGATCCATGGACG
TCAATCGAGCCGGTGGTCGACATCAACGACGTGGCTTGGTGCAAAAATACCGGCATGCTCCTGACGGCCAACGAG
GGCAAGCAGCAACACGCCTTTTTCGTCCCACAACTTGGACCAGCCCCAAAGTGGTGCTCCTTCCTCGACAACATG
GTCGAAGAGATGGCCGAAGATGTCAAGGCCGAGACCTACGACAACTACAAGTTCCTGACGCTTCCGGAACTGAAG
CAGCTGAGCCTGTCACACTTGGTGGGCAAAACCAACCTACTCCGGCCCTACATGCACGGATACTTTGTCGCATCC
AAACTGTACGAGCAGGCCAAGCTCATCGCCAATCCGTACGCATGGGAGGAGGACAGGATGAAGCGCGTCAAGGAA
AAGGTCGAAAAGGAACGAGCCAGCAGGATCAGGGGCAGCAAGAAGGTCAAGGTCAATCAGAAGCTGGCCGACCGG
CTCCTCAAGAAGCAAGAGAACCGGAACAAGGTGGATCCCAACGCTGGTCTTCTCGGAGACGAACGTTTCGCCCAG
CTTTTCGAGGACGAGGAGTTTGTTGTGGACGAGAACAGCCGGGAGTTCCAACTTCGCAATCCAAGCACAGTCGTC
AGCCAACCCGCTGATGCTGGGGCTCCCACCCGTTATCAGGCCAAGGACTCTGAGGACGAGTCAAGCGATGACGAC
GGTGGGCCCACGTCGACGAGTCGCCGCAAGGAAGAACTGGTCATGCAGGTGTCCTCGTCCCGCGAAGACAAGGTC
AAAACTCGCGACACTGCATTGGGCTCCAGGCAGCAGAAGCCGGATCGCGGAAACAGGGCACAACGGGGCGACGTG
GTAGGAGAACGACAAGTTACATTTGTTCCCCAGTCGAAGAAGAAGGCGGCGGAAGCTCCTCCTCCAAGGAAAGCA
CTCAGTGGCCGACGCAGCGCAAGCTCCAACACGTTCCGGCGGATGGAGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail