Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2620
Gene name
LocationContig_234:24369..24879
Strand-
Gene length (bp)510
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999655

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4587
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3198
Ophiocordyceps australis map64 (Brazil) OphauB2|546
Ophiocordyceps camponoti-floridani Ophcf2|06296
Ophiocordyceps camponoti-rufipedis Ophun1|2620 (this protein)
Ophiocordyceps kimflemingae Ophio5|7307
Ophiocordyceps subramaniannii Hirsu2|963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2620
MLSNLLLSLTLLLLATPSSAEVNYLAAMPMLQPRGALLPRKTATATPTVSGISEACLMAAESVLGTAPSPPPDVQ
SAILKNPQTNPCDFSTPQSLTSQFSSYSSLLASWASSNENKLTACSDLSTLGALTDCNKEQATSTRSGNLAVRPT
GYAVAACAAAAAGFAAVAL*
Coding >Ophun1|2620
ATGCTCTCCAACCTCCTCCTCTCCCTCACCCTCCTCCTCCTCGCAACTCCCTCCTCCGCAGAGGTAAACTACCTA
GCCGCCATGCCCATGCTCCAACCACGCGGAGCCCTCCTCCCGCGAAAGACAGCCACAGCCACGCCCACCGTCAGC
GGCATCTCGGAAGCATGCCTGATGGCGGCCGAGTCGGTGCTCGGAACGGCTCCGTCACCGCCGCCAGACGTCCAG
TCAGCCATCCTCAAGAATCCGCAGACGAACCCTTGCGACTTCTCGACGCCTCAGAGCCTCACCAGCCAGTTCAGC
TCCTACAGCTCCCTGCTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACC
CTCGGAGCTCTGACCGACTGCAATAAGGAACAGGCTACGAGCACTCGCTCCGGCAACCTGGCGGTTCGTCCGACG
GGATATGCCGTCGCTGCCTGTGCCGCTGCCGCTGCTGGATTCGCCGCTGTCGCTCTGTAG
Transcript >Ophun1|2620
ATGCTCTCCAACCTCCTCCTCTCCCTCACCCTCCTCCTCCTCGCAACTCCCTCCTCCGCAGAGGTAAACTACCTA
GCCGCCATGCCCATGCTCCAACCACGCGGAGCCCTCCTCCCGCGAAAGACAGCCACAGCCACGCCCACCGTCAGC
GGCATCTCGGAAGCATGCCTGATGGCGGCCGAGTCGGTGCTCGGAACGGCTCCGTCACCGCCGCCAGACGTCCAG
TCAGCCATCCTCAAGAATCCGCAGACGAACCCTTGCGACTTCTCGACGCCTCAGAGCCTCACCAGCCAGTTCAGC
TCCTACAGCTCCCTGCTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACC
CTCGGAGCTCTGACCGACTGCAATAAGGAACAGGCTACGAGCACTCGCTCCGGCAACCTGGCGGTTCGTCCGACG
GGATATGCCGTCGCTGCCTGTGCCGCTGCCGCTGCTGGATTCGCCGCTGTCGCTCTGTAG
Gene >Ophun1|2620
ATGCTCTCCAACCTCCTCCTCTCCCTCACCCTCCTCCTCCTCGCAACTCCCTCCTCCGCAGAGGTAAACTACCTA
GCCGCCATGCCCATGCTCCAACCACGCGGAGCCCTCCTCCCGCGAAAGACAGCCACAGCCACGCCCACCGTCAGC
GGCATCTCGGAAGCATGCCTGATGGCGGCCGAGTCGGTGCTCGGAACGGCTCCGTCACCGCCGCCAGACGTCCAG
TCAGCCATCCTCAAGAATCCGCAGACGAACCCTTGCGACTTCTCGACGCCTCAGAGCCTCACCAGCCAGTTCAGC
TCCTACAGCTCCCTGCTCGCCTCCTGGGCCTCGTCCAACGAGAATAAGCTTACGGCTTGCTCCGATCTGTCTACC
CTCGGAGCTCTGACCGACTGCAATAAGGAACAGGCTACGAGCACTCGCTCCGGCAACCTGGCGGTTCGTCCGACG
GGATATGCCGTCGCTGCCTGTGCCGCTGCCGCTGCTGGATTCGCCGCTGTCGCTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail