Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2615
Gene name
LocationContig_234:9281..10538
Strand-
Gene length (bp)1257
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14388 DUF4419 Domain of unknown function (DUF4419) 1.3E-88 82 381

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5UQ60|YL662_MIMIV Uncharacterized protein L662 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L662 PE=4 SV=1 55 289 2.0E-13

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999722

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup87
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2106
Ophiocordyceps australis 1348a (Ghana) OphauG2|2432
Ophiocordyceps australis 1348a (Ghana) OphauG2|3791
Ophiocordyceps australis 1348a (Ghana) OphauG2|7785
Ophiocordyceps australis map64 (Brazil) OphauB2|538
Ophiocordyceps australis map64 (Brazil) OphauB2|7106
Ophiocordyceps australis map64 (Brazil) OphauB2|8110
Ophiocordyceps camponoti-floridani Ophcf2|04348
Ophiocordyceps camponoti-floridani Ophcf2|06291
Ophiocordyceps camponoti-rufipedis Ophun1|2615 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3024
Ophiocordyceps kimflemingae Ophio5|6311
Ophiocordyceps kimflemingae Ophio5|7302
Ophiocordyceps subramaniannii Hirsu2|3102
Ophiocordyceps subramaniannii Hirsu2|9218

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2615
MASKMMLLALGLSTGLVMADISITVSDVKPLPLQNTHSVSNAAQLFEYSCPEEVQRGANVIVSSYTNKPHDMIGH
THFASSDSLVRGAIDAWAHHQSLVLRPDIVWFEILAQLNLYMTKHAEELRHLFVDFQGQQEIEVWDLTWQSVIDS
FKAEMQKRVKTNWLEGWITPGFSTSTADDNTTSTVLMMGLMQQYFKFSGGIICGLPSVTLLGNEADWQALLDKLE
NLSHFGVEPTQYAKRLRPILFMFIQTFRHPQSGQVKKFWKQIVRAEKVFTCGSGPIEYDVSGWITGFMHWTSNGD
LRVPVDLRLRGDEVKIDGITYYSAGLNTLPVGYARAPLKMMDYPEPGTSSMAYVVAGNLGILRRQIRPVGVKSQP
LSAWFLYGPVDVNATSSMGALSGGEIMSVYNGLKANCPAGTRA*
Coding >Ophun1|2615
ATGGCTTCCAAGATGATGTTGCTCGCCCTCGGGCTTTCGACTGGCCTGGTCATGGCCGATATCAGCATCACTGTC
AGTGACGTCAAGCCTCTACCGCTGCAGAACACCCACTCCGTCAGCAACGCCGCGCAGTTATTCGAGTACAGCTGT
CCCGAAGAGGTCCAACGGGGCGCCAACGTCATCGTGTCGTCGTACACCAACAAGCCACATGACATGATCGGACAC
ACGCACTTCGCCTCGTCGGATAGTCTGGTGCGGGGCGCGATTGATGCTTGGGCTCATCATCAGAGCTTGGTGTTG
AGGCCTGATATCGTCTGGTTTGAGATTCTGGCTCAGCTCAACCTTTACATGACCAAGCATGCTGAGGAGCTGCGT
CATCTCTTCGTCGACTTTCAGGGTCAGCAGGAGATTGAGGTCTGGGATCTGACTTGGCAGTCTGTTATTGATAGC
TTCAAGGCTGAGATGCAGAAGAGGGTCAAGACGAATTGGCTTGAGGGATGGATCACGCCGGGTTTCTCTACCAGT
ACGGCTGACGATAACACCACCTCGACGGTGCTCATGATGGGCCTCATGCAGCAGTATTTCAAGTTTTCTGGCGGC
ATCATCTGCGGTCTGCCTTCGGTGACGCTCCTCGGTAACGAAGCCGACTGGCAAGCTCTGTTGGATAAGCTCGAG
AACCTGAGCCACTTTGGCGTCGAACCGACTCAGTACGCCAAGAGGCTGCGGCCCATCCTCTTCATGTTCATCCAG
ACCTTCCGTCACCCTCAGAGCGGCCAAGTCAAGAAGTTCTGGAAGCAAATCGTCCGGGCTGAAAAGGTCTTTACC
TGCGGCTCAGGACCTATCGAGTATGACGTCTCGGGCTGGATCACGGGTTTCATGCACTGGACTTCGAACGGCGAC
CTGCGCGTGCCGGTCGATCTGAGGCTGAGGGGCGATGAGGTCAAGATTGATGGCATCACCTACTACAGCGCTGGG
CTGAACACGCTGCCCGTGGGATACGCCAGGGCGCCGCTTAAGATGATGGATTACCCGGAGCCGGGGACCAGCAGT
ATGGCCTACGTCGTGGCTGGAAACCTGGGCATCCTGCGGAGGCAGATTCGTCCGGTGGGCGTCAAGTCGCAGCCG
TTGAGTGCTTGGTTCTTGTATGGGCCTGTGGACGTTAATGCCACTTCGTCCATGGGGGCCCTCTCAGGAGGCGAG
ATCATGTCCGTTTATAACGGCCTCAAGGCGAATTGTCCGGCGGGGACTCGGGCTTGA
Transcript >Ophun1|2615
ATGGCTTCCAAGATGATGTTGCTCGCCCTCGGGCTTTCGACTGGCCTGGTCATGGCCGATATCAGCATCACTGTC
AGTGACGTCAAGCCTCTACCGCTGCAGAACACCCACTCCGTCAGCAACGCCGCGCAGTTATTCGAGTACAGCTGT
CCCGAAGAGGTCCAACGGGGCGCCAACGTCATCGTGTCGTCGTACACCAACAAGCCACATGACATGATCGGACAC
ACGCACTTCGCCTCGTCGGATAGTCTGGTGCGGGGCGCGATTGATGCTTGGGCTCATCATCAGAGCTTGGTGTTG
AGGCCTGATATCGTCTGGTTTGAGATTCTGGCTCAGCTCAACCTTTACATGACCAAGCATGCTGAGGAGCTGCGT
CATCTCTTCGTCGACTTTCAGGGTCAGCAGGAGATTGAGGTCTGGGATCTGACTTGGCAGTCTGTTATTGATAGC
TTCAAGGCTGAGATGCAGAAGAGGGTCAAGACGAATTGGCTTGAGGGATGGATCACGCCGGGTTTCTCTACCAGT
ACGGCTGACGATAACACCACCTCGACGGTGCTCATGATGGGCCTCATGCAGCAGTATTTCAAGTTTTCTGGCGGC
ATCATCTGCGGTCTGCCTTCGGTGACGCTCCTCGGTAACGAAGCCGACTGGCAAGCTCTGTTGGATAAGCTCGAG
AACCTGAGCCACTTTGGCGTCGAACCGACTCAGTACGCCAAGAGGCTGCGGCCCATCCTCTTCATGTTCATCCAG
ACCTTCCGTCACCCTCAGAGCGGCCAAGTCAAGAAGTTCTGGAAGCAAATCGTCCGGGCTGAAAAGGTCTTTACC
TGCGGCTCAGGACCTATCGAGTATGACGTCTCGGGCTGGATCACGGGTTTCATGCACTGGACTTCGAACGGCGAC
CTGCGCGTGCCGGTCGATCTGAGGCTGAGGGGCGATGAGGTCAAGATTGATGGCATCACCTACTACAGCGCTGGG
CTGAACACGCTGCCCGTGGGATACGCCAGGGCGCCGCTTAAGATGATGGATTACCCGGAGCCGGGGACCAGCAGT
ATGGCCTACGTCGTGGCTGGAAACCTGGGCATCCTGCGGAGGCAGATTCGTCCGGTGGGCGTCAAGTCGCAGCCG
TTGAGTGCTTGGTTCTTGTATGGGCCTGTGGACGTTAATGCCACTTCGTCCATGGGGGCCCTCTCAGGAGGCGAG
ATCATGTCCGTTTATAACGGCCTCAAGGCGAATTGTCCGGCGGGGACTCGGGCTTGA
Gene >Ophun1|2615
ATGGCTTCCAAGATGATGTTGCTCGCCCTCGGGCTTTCGACTGGCCTGGTCATGGCCGATATCAGCATCACTGTC
AGTGACGTCAAGCCTCTACCGCTGCAGAACACCCACTCCGTCAGCAACGCCGCGCAGTTATTCGAGTACAGCTGT
CCCGAAGAGGTCCAACGGGGCGCCAACGTCATCGTGTCGTCGTACACCAACAAGCCACATGACATGATCGGACAC
ACGCACTTCGCCTCGTCGGATAGTCTGGTGCGGGGCGCGATTGATGCTTGGGCTCATCATCAGAGCTTGGTGTTG
AGGCCTGATATCGTCTGGTTTGAGATTCTGGCTCAGCTCAACCTTTACATGACCAAGCATGCTGAGGAGCTGCGT
CATCTCTTCGTCGACTTTCAGGGTCAGCAGGAGATTGAGGTCTGGGATCTGACTTGGCAGTCTGTTATTGATAGC
TTCAAGGCTGAGATGCAGAAGAGGGTCAAGACGAATTGGCTTGAGGGATGGATCACGCCGGGTTTCTCTACCAGT
ACGGCTGACGATAACACCACCTCGACGGTGCTCATGATGGGCCTCATGCAGCAGTATTTCAAGTTTTCTGGCGGC
ATCATCTGCGGTCTGCCTTCGGTGACGCTCCTCGGTAACGAAGCCGACTGGCAAGCTCTGTTGGATAAGCTCGAG
AACCTGAGCCACTTTGGCGTCGAACCGACTCAGTACGCCAAGAGGCTGCGGCCCATCCTCTTCATGTTCATCCAG
ACCTTCCGTCACCCTCAGAGCGGCCAAGTCAAGAAGTTCTGGAAGCAAATCGTCCGGGCTGAAAAGGTCTTTACC
TGCGGCTCAGGACCTATCGAGTATGACGTCTCGGGCTGGATCACGGGTTTCATGCACTGGACTTCGAACGGCGAC
CTGCGCGTGCCGGTCGATCTGAGGCTGAGGGGCGATGAGGTCAAGATTGATGGCATCACCTACTACAGCGCTGGG
CTGAACACGCTGCCCGTGGGATACGCCAGGGCGCCGCTTAAGATGATGGATTACCCGGAGCCGGGGACCAGCAGT
ATGGCCTACGTCGTGGCTGGAAACCTGGGCATCCTGCGGAGGCAGATTCGTCCGGTGGGCGTCAAGTCGCAGCCG
TTGAGTGCTTGGTTCTTGTATGGGCCTGTGGACGTTAATGCCACTTCGTCCATGGGGGCCCTCTCAGGAGGCGAG
ATCATGTCCGTTTATAACGGCCTCAAGGCGAATTGTCCGGCGGGGACTCGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail