Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2611
Gene name
LocationContig_234:783..1967
Strand-
Gene length (bp)1184
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09994 DUF2235 Uncharacterized alpha/beta hydrolase domain (DUF2235) 2.1E-63 32 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39992|YEC3_YEAST Uncharacterized protein YEL023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL023C PE=4 SV=1 39 218 5.0E-31

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 221 243 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2611
MALPPRLLDPGWPPAARHEEVEAGAMSPQTGFHGDDSDSNILKIFRMLDRTAADQYHYYQPGIGTYVVSGSLSHT
GIRARINSWYSKAKDSAVGSSFDQHVVGGYRFLMRFYSPGDEIYMFGFSRGAYIARFLAEMLDHIGLLSHGNEEM
VKFAWKAFAQWQSRRGQQSSEEEEGVEGGDGACKAHALHDYIKGFRETFSRPVGRIRFLGLFDTVNSVPRVGGGI
MTAIIIIIIIIGIFIIFISMLDTCWSRCVGASTGEEDEDPWPRLNHLRTNSRRRDGGQPLASAMPPTDHAPLDLR
C*
Coding >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGATCGG
ACGGCGGCGGATCAGTATCATTACTACCAGCCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACACG
GGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCAT
GTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCGA
GGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGATG
GTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGGG
GTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTCG
AGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGAGTCGGGGGGGGGATC
ATGACGGCCATCATCATCATCATCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGG
AGCCGTTGCGTCGGAGCATCGACGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAAC
AGCAGACGGAGAGACGGGGGTCAACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGA
TGCTGA
Transcript >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGATCGG
ACGGCGGCGGATCAGTATCATTACTACCAGCCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACACG
GGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCAT
GTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCGA
GGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGATG
GTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGGG
GTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTCG
AGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGAGTCGGGGGGGGGATC
ATGACGGCCATCATCATCATCATCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGG
AGCCGTTGCGTCGGAGCATCGACGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAAC
AGCAGACGGAGAGACGGGGGTCAACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGA
TGCTGA
Gene >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTGTGAGTGGGATGCGGAGGGGGGAGAAGGGGAGGGGGCCTAAGAAACTGGTTCTTTGC
TTTGATGGGACGGGGAATAAGTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGAT
CGGACGGCGGCGGATCAGTATCATTACTACCAGCGTGAGAGATTTCTTTTCCCCTTCTTCCCCTGATTGACGGAG
CGGAACAAGACTGACGACGGTTGGGGATTCAGCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACAC
GGGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCA
TGTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCG
AGGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGAT
GGTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGG
GGTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTC
GAGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGGTTTGAGGCTGCTTG
GATGCAGAGGAGTAAGTTTCCTTATACGGCCAGGAGCAGTGCGAGGGTTATTCGGCATGCGGTTAGCATTGATGA
GCGGAGGGCCAAGTTTCGACAGGATTTGATGTATCAGAGTCGGGGGGGGGATCATGACGGCCATCATCATCATCA
TCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGGAGCCGTTGCGTCGGAGCATCGA
CGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAACAGCAGACGGAGAGACGGGGGTC
AACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail