Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2611
Gene name
LocationContig_234:783..1967
Strand-
Gene length (bp)1184
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09994 DUF2235 Uncharacterized alpha/beta hydrolase domain (DUF2235) 2.1E-63 32 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P39992|YEC3_YEAST Uncharacterized protein YEL023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL023C PE=4 SV=1 39 218 5.0E-31

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 221 243 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2892
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1443
Ophiocordyceps australis map64 (Brazil) OphauB2|534
Ophiocordyceps camponoti-floridani Ophcf2|06287
Ophiocordyceps camponoti-rufipedis Ophun1|2611 (this protein)
Ophiocordyceps kimflemingae Ophio5|7298
Ophiocordyceps subramaniannii Hirsu2|482

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2611
MALPPRLLDPGWPPAARHEEVEAGAMSPQTGFHGDDSDSNILKIFRMLDRTAADQYHYYQPGIGTYVVSGSLSHT
GIRARINSWYSKAKDSAVGSSFDQHVVGGYRFLMRFYSPGDEIYMFGFSRGAYIARFLAEMLDHIGLLSHGNEEM
VKFAWKAFAQWQSRRGQQSSEEEEGVEGGDGACKAHALHDYIKGFRETFSRPVGRIRFLGLFDTVNSVPRVGGGI
MTAIIIIIIIIGIFIIFISMLDTCWSRCVGASTGEEDEDPWPRLNHLRTNSRRRDGGQPLASAMPPTDHAPLDLR
C*
Coding >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGATCGG
ACGGCGGCGGATCAGTATCATTACTACCAGCCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACACG
GGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCAT
GTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCGA
GGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGATG
GTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGGG
GTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTCG
AGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGAGTCGGGGGGGGGATC
ATGACGGCCATCATCATCATCATCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGG
AGCCGTTGCGTCGGAGCATCGACGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAAC
AGCAGACGGAGAGACGGGGGTCAACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGA
TGCTGA
Transcript >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGATCGG
ACGGCGGCGGATCAGTATCATTACTACCAGCCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACACG
GGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCAT
GTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCGA
GGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGATG
GTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGGG
GTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTCG
AGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGAGTCGGGGGGGGGATC
ATGACGGCCATCATCATCATCATCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGG
AGCCGTTGCGTCGGAGCATCGACGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAAC
AGCAGACGGAGAGACGGGGGTCAACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGA
TGCTGA
Gene >Ophun1|2611
ATGGCGCTGCCTCCTCGCCTCCTCGACCCGGGATGGCCACCGGCTGCTCGCCACGAAGAAGTTGAGGCTGGTGCT
ATGAGTCCGCAGACGGGTGTGAGTGGGATGCGGAGGGGGGAGAAGGGGAGGGGGCCTAAGAAACTGGTTCTTTGC
TTTGATGGGACGGGGAATAAGTTTCATGGCGATGACAGTGATAGCAATATTCTCAAGATTTTCCGCATGTTGGAT
CGGACGGCGGCGGATCAGTATCATTACTACCAGCGTGAGAGATTTCTTTTCCCCTTCTTCCCCTGATTGACGGAG
CGGAACAAGACTGACGACGGTTGGGGATTCAGCTGGGATTGGGACATATGTCGTCTCCGGCTCGCTCTCTCACAC
GGGGATTCGGGCGCGTATCAACTCGTGGTATTCCAAGGCCAAGGACTCGGCTGTTGGGTCGTCTTTTGATCAGCA
TGTTGTAGGAGGCTATCGCTTCCTCATGCGCTTCTACTCCCCCGGCGATGAGATCTACATGTTTGGCTTCAGCCG
AGGAGCCTACATTGCGCGATTCCTAGCCGAGATGCTGGACCACATCGGACTGCTATCGCACGGAAACGAGGAGAT
GGTCAAGTTCGCGTGGAAGGCCTTCGCGCAGTGGCAGTCTCGAAGGGGGCAGCAGAGCAGCGAGGAGGAGGAGGG
GGTGGAAGGGGGGGACGGTGCGTGCAAGGCGCACGCTCTGCATGATTATATCAAGGGGTTTCGCGAGACGTTTTC
GAGGCCGGTGGGGAGGATTCGGTTCTTGGGGCTGTTTGATACGGTGAATTCGGTGCCGAGGTTTGAGGCTGCTTG
GATGCAGAGGAGTAAGTTTCCTTATACGGCCAGGAGCAGTGCGAGGGTTATTCGGCATGCGGTTAGCATTGATGA
GCGGAGGGCCAAGTTTCGACAGGATTTGATGTATCAGAGTCGGGGGGGGGATCATGACGGCCATCATCATCATCA
TCATCATCATCGGCATCTTCATCATCTTCATCAGCATGTTGGACACTTGTTGGAGCCGTTGCGTCGGAGCATCGA
CGGGAGAGGAGGACGAGGATCCGTGGCCGAGGCTGAACCATCTCCGAACCAACAGCAGACGGAGAGACGGGGGTC
AACCGCTGGCCAGCGCTATGCCCCCTACCGACCACGCGCCTCTCGACCTCAGATGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail