Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2608
Gene name
LocationContig_233:16142..18963
Strand+
Gene length (bp)2821
Transcript length (bp)2700
Coding sequence length (bp)2700
Protein length (aa) 900

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08632 Zds_C Activator of mitotic machinery Cdc14 phosphatase activation C-term 1.9E-28 732 782

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 728 834 3.0E-17
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 164 378 7.0E-15
sp|P50111|ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS1 PE=1 SV=1 740 781 4.0E-09
sp|P54786|ZDS2_YEAST Protein ZDS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS2 PE=1 SV=1 740 781 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2608
MTSSRPRDDIAGSRRGHASQLSISDPSHHVTEAIGTLYGDEDDSGSEGGRPMSFISGSPYNEELHRMSPPELHER
PPNHQHASEKSTSYPPHDQPSDSSSSTQVEHGNLRKLQNLVSTSPSQRSNNSYELSSQSPVSPTPSLRDVQADST
GSQFPLTNIDNPSDIAQELSNLQALRRLSMDVGNNIDPDMPPMGFSVMPPVAPSGNDDENDPSRLLWVPARVHPE
LAPTEFKTFLEKRVQSIRRRSGDPLLAADFEAGLGRSESLLRRNKSTLSRQIDNTGGRGAVGYVDGSERLERQRS
SSGSQHGPELSLDELVKDPTKAVQRLAQETQSASVGAEGGSDDMPILPMAPGVGLRRSTRTTYRKGGSLRSRDRG
SFSRRLPQRQSEGDYTDMSSTAASEVAKGPMTAAASTESATDTHSQPARAGRRPRNLSQETTHVMAGADGPSEEN
MESRPSTRAQGPRVRTPSDSGGEPSLPPERSERSDSPVVRSFPQRSSSQNAMPLHDHHPEASEDVTSRPSRRPTI
GNITKLPAQSQYITKSPNSMHLHTMSDSLASPSSLIGADASRTDSLTFIPTFSQPEKKPDKKSSKKDRDEDSSST
SSRSGSAWKWLKGVTDDRDRKKEEGRKSKTRASAERTQDNVRLDVIQTSIDRSNAKGRESLVLDRDNVDSKLLEE
RKKENNRKSDSKKEKDGSIFSSIFGGSKKKEEKEKVHKKSQQYLQVPEDVSFKPLTPDVDYNWSRFPLLEERAIY
RMAHIKLANPRRSLLSQVLLSNFMYSYLAIVQTMHPQMNVPTSPQQKRLEEEARRKRREEEYLARQGEHASEHSL
DQYNYDYHRAAVQYADSGADGQTDYVDEAQIYEDEHGDDDDEYGYEGVDGSGREAKEYLHDQDDHRRHRQDDMW*
Coding >Ophun1|2608
ATGACCTCATCTAGGCCGCGTGACGATATCGCTGGCAGCCGGCGTGGCCATGCCAGCCAGCTCTCCATTTCTGAT
CCGAGCCACCATGTAACCGAAGCCATCGGCACTCTCTACGGCGACGAGGACGACTCTGGCTCAGAGGGTGGCCGG
CCCATGAGCTTCATCAGCGGATCTCCATACAATGAAGAATTGCATCGGATGTCGCCGCCCGAGCTGCATGAACGG
CCGCCCAATCATCAGCATGCAAGCGAAAAGTCGACATCGTACCCTCCCCACGACCAGCCGTCGGACTCGTCGTCG
TCCACCCAGGTTGAGCATGGCAACCTCAGGAAGTTGCAAAATCTGGTCTCGACGTCGCCCTCACAGCGGAGTAAC
AATTCGTACGAACTCAGCTCCCAATCGCCTGTTTCACCGACGCCATCGCTACGAGATGTCCAGGCGGATTCGACC
GGATCTCAATTTCCACTGACCAACATAGATAATCCGAGCGATATTGCTCAAGAGTTGAGCAACCTGCAGGCTCTC
AGGAGACTTTCCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGTCATGCCCCCG
GTGGCTCCCAGCGGAAACGATGACGAGAACGATCCATCCAGGCTTCTTTGGGTCCCGGCCAGGGTCCACCCGGAA
CTGGCGCCGACAGAATTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGGAGGTCGGGGGATCCTCTT
CTCGCCGCCGACTTCGAGGCGGGCCTCGGCCGTTCCGAGTCGCTGTTGAGAAGGAACAAATCAACGCTCTCACGG
CAAATTGACAACACTGGTGGCCGTGGAGCAGTGGGCTATGTTGACGGTTCTGAGCGTCTCGAGCGACAGAGGTCG
TCAAGCGGCAGCCAGCACGGCCCTGAGCTCAGCCTCGACGAGTTGGTCAAGGATCCGACGAAAGCGGTCCAGAGA
CTCGCACAGGAGACTCAGAGTGCTTCGGTGGGCGCTGAAGGCGGCAGTGACGACATGCCCATTCTTCCCATGGCT
CCGGGGGTGGGTTTGCGCCGATCCACTCGCACCACGTATCGCAAGGGCGGAAGTTTGCGATCTCGAGACCGGGGG
TCATTCTCGAGGCGTCTCCCTCAGCGACAGTCAGAAGGCGACTACACTGACATGAGCAGCACGGCTGCATCAGAA
GTGGCCAAGGGACCTATGACCGCAGCGGCTTCAACAGAGTCGGCCACAGACACACACTCCCAACCTGCACGAGCC
GGACGGCGCCCCAGGAACTTGTCGCAAGAAACAACACACGTCATGGCTGGTGCCGACGGCCCCTCCGAAGAGAAC
ATGGAGTCTCGCCCGTCGACTCGGGCCCAGGGGCCTCGCGTTCGAACACCCTCGGATTCTGGTGGAGAACCATCT
CTACCCCCAGAGCGGTCAGAACGATCGGACAGCCCAGTGGTCAGATCGTTTCCCCAGAGGTCGTCGTCTCAAAAC
GCAATGCCACTTCACGATCATCACCCCGAAGCCTCCGAGGATGTTACTAGTCGCCCGAGCAGACGTCCAACAATT
GGCAACATCACGAAGCTGCCAGCGCAGTCTCAATACATCACAAAATCGCCAAACTCGATGCATTTGCACACCATG
AGCGACTCGCTGGCATCACCTTCCTCCCTCATTGGCGCGGATGCCTCTCGTACTGACAGCCTGACATTCATTCCC
ACGTTTAGCCAACCCGAAAAGAAGCCAGACAAGAAATCGTCGAAAAAGGACAGAGATGAGGACTCATCCAGCACT
TCGAGCAGGTCGGGCAGCGCATGGAAATGGCTCAAGGGCGTCACCGACGACAGAGATCGGAAGAAGGAGGAGGGA
AGGAAGTCCAAGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACATCCATC
GACAGAAGTAACGCCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTGGAAGAG
AGGAAGAAGGAGAACAATCGCAAGAGCGACTCGAAGAAAGAGAAGGACGGTAGCATCTTCTCCTCTATCTTTGGG
GGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTCACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAAGACGTT
TCCTTCAAGCCTTTGACCCCGGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCCATCTAC
CGCATGGCGCACATCAAGCTAGCCAACCCGCGTCGCTCACTCCTCAGCCAGGTGCTCCTCAGCAACTTCATGTAC
AGCTACCTGGCGATTGTGCAGACGATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGACTGGAG
GAGGAAGCGAGGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGAACACAGCCTC
GACCAGTACAACTATGACTATCACAGGGCTGCTGTCCAGTATGCCGATTCGGGGGCAGATGGGCAGACTGACTAT
GTCGACGAAGCTCAGATCTACGAAGATGAGCATGGGGACGACGACGACGAATACGGCTACGAAGGCGTTGATGGC
TCCGGTCGCGAAGCCAAGGAGTATCTTCACGACCAAGACGATCATCGACGGCACCGGCAAGACGACATGTGGTAA
Transcript >Ophun1|2608
ATGACCTCATCTAGGCCGCGTGACGATATCGCTGGCAGCCGGCGTGGCCATGCCAGCCAGCTCTCCATTTCTGAT
CCGAGCCACCATGTAACCGAAGCCATCGGCACTCTCTACGGCGACGAGGACGACTCTGGCTCAGAGGGTGGCCGG
CCCATGAGCTTCATCAGCGGATCTCCATACAATGAAGAATTGCATCGGATGTCGCCGCCCGAGCTGCATGAACGG
CCGCCCAATCATCAGCATGCAAGCGAAAAGTCGACATCGTACCCTCCCCACGACCAGCCGTCGGACTCGTCGTCG
TCCACCCAGGTTGAGCATGGCAACCTCAGGAAGTTGCAAAATCTGGTCTCGACGTCGCCCTCACAGCGGAGTAAC
AATTCGTACGAACTCAGCTCCCAATCGCCTGTTTCACCGACGCCATCGCTACGAGATGTCCAGGCGGATTCGACC
GGATCTCAATTTCCACTGACCAACATAGATAATCCGAGCGATATTGCTCAAGAGTTGAGCAACCTGCAGGCTCTC
AGGAGACTTTCCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGTCATGCCCCCG
GTGGCTCCCAGCGGAAACGATGACGAGAACGATCCATCCAGGCTTCTTTGGGTCCCGGCCAGGGTCCACCCGGAA
CTGGCGCCGACAGAATTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGGAGGTCGGGGGATCCTCTT
CTCGCCGCCGACTTCGAGGCGGGCCTCGGCCGTTCCGAGTCGCTGTTGAGAAGGAACAAATCAACGCTCTCACGG
CAAATTGACAACACTGGTGGCCGTGGAGCAGTGGGCTATGTTGACGGTTCTGAGCGTCTCGAGCGACAGAGGTCG
TCAAGCGGCAGCCAGCACGGCCCTGAGCTCAGCCTCGACGAGTTGGTCAAGGATCCGACGAAAGCGGTCCAGAGA
CTCGCACAGGAGACTCAGAGTGCTTCGGTGGGCGCTGAAGGCGGCAGTGACGACATGCCCATTCTTCCCATGGCT
CCGGGGGTGGGTTTGCGCCGATCCACTCGCACCACGTATCGCAAGGGCGGAAGTTTGCGATCTCGAGACCGGGGG
TCATTCTCGAGGCGTCTCCCTCAGCGACAGTCAGAAGGCGACTACACTGACATGAGCAGCACGGCTGCATCAGAA
GTGGCCAAGGGACCTATGACCGCAGCGGCTTCAACAGAGTCGGCCACAGACACACACTCCCAACCTGCACGAGCC
GGACGGCGCCCCAGGAACTTGTCGCAAGAAACAACACACGTCATGGCTGGTGCCGACGGCCCCTCCGAAGAGAAC
ATGGAGTCTCGCCCGTCGACTCGGGCCCAGGGGCCTCGCGTTCGAACACCCTCGGATTCTGGTGGAGAACCATCT
CTACCCCCAGAGCGGTCAGAACGATCGGACAGCCCAGTGGTCAGATCGTTTCCCCAGAGGTCGTCGTCTCAAAAC
GCAATGCCACTTCACGATCATCACCCCGAAGCCTCCGAGGATGTTACTAGTCGCCCGAGCAGACGTCCAACAATT
GGCAACATCACGAAGCTGCCAGCGCAGTCTCAATACATCACAAAATCGCCAAACTCGATGCATTTGCACACCATG
AGCGACTCGCTGGCATCACCTTCCTCCCTCATTGGCGCGGATGCCTCTCGTACTGACAGCCTGACATTCATTCCC
ACGTTTAGCCAACCCGAAAAGAAGCCAGACAAGAAATCGTCGAAAAAGGACAGAGATGAGGACTCATCCAGCACT
TCGAGCAGGTCGGGCAGCGCATGGAAATGGCTCAAGGGCGTCACCGACGACAGAGATCGGAAGAAGGAGGAGGGA
AGGAAGTCCAAGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACATCCATC
GACAGAAGTAACGCCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTGGAAGAG
AGGAAGAAGGAGAACAATCGCAAGAGCGACTCGAAGAAAGAGAAGGACGGTAGCATCTTCTCCTCTATCTTTGGG
GGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTCACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAAGACGTT
TCCTTCAAGCCTTTGACCCCGGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCCATCTAC
CGCATGGCGCACATCAAGCTAGCCAACCCGCGTCGCTCACTCCTCAGCCAGGTGCTCCTCAGCAACTTCATGTAC
AGCTACCTGGCGATTGTGCAGACGATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGACTGGAG
GAGGAAGCGAGGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGAACACAGCCTC
GACCAGTACAACTATGACTATCACAGGGCTGCTGTCCAGTATGCCGATTCGGGGGCAGATGGGCAGACTGACTAT
GTCGACGAAGCTCAGATCTACGAAGATGAGCATGGGGACGACGACGACGAATACGGCTACGAAGGCGTTGATGGC
TCCGGTCGCGAAGCCAAGGAGTATCTTCACGACCAAGACGATCATCGACGGCACCGGCAAGACGACATGTGGTAA
Gene >Ophun1|2608
ATGGTGCGTCGTCTCTCATTGTCGTCCGTTCGATAGACCATGATTATACTGACTCCCCGTTGCATAAGACCTCAT
CTAGGCCGCGTGACGATATCGCTGGCAGCCGGCGTGGCCATGCCAGCCAGCTCTCCATTTCTGATCCGAGCCACC
ATGTAACCGAAGCCATCGGCACTCTCTACGGCGACGAGGACGACTCTGGCTCAGAGGGTGGCCGGCCCATGAGCT
TCATCAGCGGATCTCCATACAATGAAGAATTGCATCGGATGTCGCCGCCCGAGCTGCATGAACGGCCGCCCAATC
ATCAGCATGCAAGCGAAAAGTCGACATCGTACCCTCCCCACGACCAGCCGTCGGACTCGTCGTCGTCCACCCAGG
TTGAGCATGGCAACCTCAGGAAGTTGCAAAATCTGGTCTCGACGTCGCCCTCACAGCGGAGTAACAATTCGTACG
AACTCAGCTCCCAATCGCCTGTTTCACCGACGCCATCGCTACGAGATGTCCAGGCGGATTCGACCGGATCTCAAT
TTCCACTGACCAACATAGATAATCCGAGCGATATTGCTCAAGAGTTGAGCAACCTGCAGGCTCTCAGGAGACTTT
CCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGTCATGCCCCCGGTGGCTCCCA
GCGGAAACGATGACGAGAACGATCCATCCAGGCTTCTTTGGGTCCCGGCCAGGGTCCACCCGGAACTGGCGCCGA
CAGAATTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGGAGGTCGGGGGATCCTCTTCTCGCCGCCG
ACTTCGAGGCGGGCCTCGGCCGTTCCGAGTCGCTGTTGAGAAGGAACAAATCAACGCTCTCACGGCAAATTGACA
ACACTGGTGGCCGTGGAGCAGTGGGCTATGTTGACGGTTCTGAGCGTCTCGAGCGACAGAGGTCGTCAAGCGGCA
GCCAGCACGGCCCTGAGCTCAGCCTCGACGAGTTGGTCAAGGATCCGACGAAAGCGGTCCAGAGACTCGCACAGG
AGACTCAGAGTGCTTCGGTGGGCGCTGAAGGCGGCAGTGACGACATGCCCATTCTTCCCATGGCTCCGGGGGTGG
GTTTGCGCCGATCCACTCGCACCACGTATCGCAAGGGCGGAAGTTTGCGATCTCGAGACCGGGGGTCATTCTCGA
GGCGTCTCCCTCAGCGACAGTCAGAAGGCGACTACACTGACATGAGCAGCACGGCTGCATCAGAAGTGGCCAAGG
GACCTATGACCGCAGCGGCTTCAACAGAGTCGGCCACAGACACACACTCCCAACCTGCACGAGCCGGACGGCGCC
CCAGGAACTTGTCGCAAGAAACAACACACGTCATGGCTGGTGCCGACGGCCCCTCCGAAGAGAACATGGAGTCTC
GCCCGTCGACTCGGGCCCAGGGGCCTCGCGTTCGAACACCCTCGGATTCTGGTGGAGAACCATCTCTACCCCCAG
AGCGGTCAGAACGATCGGACAGCCCAGTGGTCAGATCGTTTCCCCAGAGGTCGTCGTCTCAAAACGCAATGCCAC
TTCACGATCATCACCCCGAAGCCTCCGAGGATGTTACTAGTCGCCCGAGCAGACGTCCAACAATTGGCAACATCA
CGAAGCTGCCAGCGCAGTCTCAATACATCACAAAATCGCCAAACTCGATGCATTTGCACACCATGAGCGACTCGC
TGGCATCACCTTCCTCCCTCATTGGCGCGGATGCCTCTCGTACTGACAGCCTGACATTCATTCCCACGTTTAGCC
AACCCGAAAAGAAGCCAGACAAGAAATCGTCGAAAAAGGACAGAGATGAGGACTCATCCAGCACTTCGAGCAGGT
CGGGCAGCGCATGGAAATGGCTCAAGGGCGTCACCGACGACAGAGATCGGAAGAAGGAGGAGGGAAGGAAGTCCA
AGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACATCCATCGACAGAAGTA
ACGCCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTGGAAGAGAGGAAGAAGG
AGAACAATCGCAAGAGCGACTCGAAGAAAGAGAAGGACGGTAGCATCTTCTCCTCTATCTTTGGGGGAAGCAAGA
AGAAGGAAGAGAAGGAAAAGGTTCACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAAGACGTTTCCTTCAAGC
CTTTGACCCCGGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCCATCTACCGCATGGCGC
ACATCAAGCTAGCCAACCCGCGTCGCTCACTCCTCAGCCAGGTGCTCCTCAGCAACTTCATGTACAGCTACCTGG
CGATTGTGCAGACGATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGACTGGAGGAGGAAGCGA
GGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGAACACAGCCTCGACCAGTACA
ACTATGACTATCACAGGGTAGGTCTCCGCTGCATGGATTTTCTCTGCGCCGGCTCTTGCTGACGGCCCTCGAGGC
TGCTGTCCAGTATGCCGATTCGGGGGCAGATGGGCAGACTGACTATGTCGACGAAGCTCAGATCTACGAAGATGA
GCATGGGGACGACGACGACGAATACGGCTACGAAGGCGTTGATGGCTCCGGTCGCGAAGCCAAGGAGTATCTTCA
CGACCAAGACGATCATCGACGGCACCGGCAAGACGACATGTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail