Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|260
Gene name
LocationContig_106:26104..27303
Strand+
Gene length (bp)1199
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10501 Ribosomal_L50 Ribosomal subunit 39S 5.6E-08 253 329

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3366
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7527
Ophiocordyceps australis map64 (Brazil) OphauB2|6967
Ophiocordyceps camponoti-floridani Ophcf2|01106
Ophiocordyceps camponoti-rufipedis Ophun1|260 (this protein)
Ophiocordyceps kimflemingae Ophio5|6843
Ophiocordyceps subramaniannii Hirsu2|6257

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|260
MPRLPGARSLKLLRLAASTPRPATATCTLTTTSSARGETTSWVRRKLWRSEPPGPEDPYTQRSEATQPAPDTEET
TKPARVARDNTPKSIRRSRLIVPPRRTEAATPEQAKERDPNYVPAEDGKDLELIATLDNWWQRPGHWGEESKFKG
FGNSTIVTNRAVIEATLCRAFFEVTALQQTGHFAEWMAKPWYVGGKKALRLILETKFPAKDTTLHNFNASHISQH
VRGTADRSEDDETHRMSVEEAQEAIKQWGSKMREIQLSDEAKFAIRKRVYQLTGNLIADSKLGASRTLRDLLLVT
GKEPKPMRLTVELRERGELDSLPNVTVHKQRVGIITKETNLGRWKLIQQELGKRGLPERGPANASGLVEAKWLSG
RA*
Coding >Ophun1|260
ATGCCTCGGCTACCCGGGGCGAGGAGTCTGAAGCTCCTCAGATTGGCAGCCTCAACTCCCCGACCGGCGACGGCG
ACTTGCACCTTAACGACGACGAGCTCGGCACGGGGCGAGACCACCTCGTGGGTGCGCAGGAAGCTCTGGCGTAGC
GAACCACCCGGTCCCGAAGACCCCTACACTCAACGGTCAGAGGCTACCCAACCGGCTCCGGACACGGAGGAGACG
ACAAAGCCGGCACGAGTAGCTCGGGATAACACGCCGAAATCGATCAGGCGATCGCGTCTTATCGTACCTCCGAGG
CGGACCGAAGCAGCCACCCCGGAGCAGGCGAAGGAGCGGGATCCGAATTACGTGCCGGCCGAAGATGGAAAGGAC
CTGGAGCTGATTGCGACGCTCGATAATTGGTGGCAGCGGCCGGGCCACTGGGGCGAGGAGAGCAAGTTCAAGGGC
TTCGGGAACTCTACCATCGTGACGAATCGCGCCGTCATCGAAGCCACACTTTGCAGGGCTTTCTTCGAGGTCACT
GCTCTGCAGCAGACGGGGCATTTTGCCGAGTGGATGGCCAAGCCGTGGTACGTGGGCGGCAAGAAGGCACTTCGT
CTGATACTCGAGACCAAGTTTCCGGCCAAGGACACGACACTGCACAATTTCAACGCCAGTCACATCTCACAACAT
GTCCGGGGTACGGCCGATAGGTCTGAGGATGACGAGACTCATCGCATGTCGGTGGAGGAGGCCCAGGAAGCCATC
AAGCAGTGGGGTAGCAAGATGCGTGAGATCCAGCTCAGCGACGAAGCCAAGTTTGCGATCCGCAAGCGTGTCTAC
CAACTCACGGGCAATCTCATCGCCGACTCCAAGCTGGGAGCTTCCAGGACGCTGCGTGACTTGCTACTCGTGACT
GGAAAAGAGCCCAAGCCGATGCGACTGACCGTGGAGCTACGCGAGCGCGGAGAACTAGATAGCCTGCCCAACGTG
ACGGTGCACAAACAGAGGGTCGGCATCATCACCAAGGAGACTAATCTCGGGCGCTGGAAGTTGATTCAGCAGGAG
CTCGGCAAGCGCGGTCTTCCTGAACGGGGTCCGGCGAATGCTTCGGGCCTGGTCGAGGCAAAGTGGTTGTCGGGT
AGGGCGTAG
Transcript >Ophun1|260
ATGCCTCGGCTACCCGGGGCGAGGAGTCTGAAGCTCCTCAGATTGGCAGCCTCAACTCCCCGACCGGCGACGGCG
ACTTGCACCTTAACGACGACGAGCTCGGCACGGGGCGAGACCACCTCGTGGGTGCGCAGGAAGCTCTGGCGTAGC
GAACCACCCGGTCCCGAAGACCCCTACACTCAACGGTCAGAGGCTACCCAACCGGCTCCGGACACGGAGGAGACG
ACAAAGCCGGCACGAGTAGCTCGGGATAACACGCCGAAATCGATCAGGCGATCGCGTCTTATCGTACCTCCGAGG
CGGACCGAAGCAGCCACCCCGGAGCAGGCGAAGGAGCGGGATCCGAATTACGTGCCGGCCGAAGATGGAAAGGAC
CTGGAGCTGATTGCGACGCTCGATAATTGGTGGCAGCGGCCGGGCCACTGGGGCGAGGAGAGCAAGTTCAAGGGC
TTCGGGAACTCTACCATCGTGACGAATCGCGCCGTCATCGAAGCCACACTTTGCAGGGCTTTCTTCGAGGTCACT
GCTCTGCAGCAGACGGGGCATTTTGCCGAGTGGATGGCCAAGCCGTGGTACGTGGGCGGCAAGAAGGCACTTCGT
CTGATACTCGAGACCAAGTTTCCGGCCAAGGACACGACACTGCACAATTTCAACGCCAGTCACATCTCACAACAT
GTCCGGGGTACGGCCGATAGGTCTGAGGATGACGAGACTCATCGCATGTCGGTGGAGGAGGCCCAGGAAGCCATC
AAGCAGTGGGGTAGCAAGATGCGTGAGATCCAGCTCAGCGACGAAGCCAAGTTTGCGATCCGCAAGCGTGTCTAC
CAACTCACGGGCAATCTCATCGCCGACTCCAAGCTGGGAGCTTCCAGGACGCTGCGTGACTTGCTACTCGTGACT
GGAAAAGAGCCCAAGCCGATGCGACTGACCGTGGAGCTACGCGAGCGCGGAGAACTAGATAGCCTGCCCAACGTG
ACGGTGCACAAACAGAGGGTCGGCATCATCACCAAGGAGACTAATCTCGGGCGCTGGAAGTTGATTCAGCAGGAG
CTCGGCAAGCGCGGTCTTCCTGAACGGGGTCCGGCGAATGCTTCGGGCCTGGTCGAGGCAAAGTGGTTGTCGGGT
AGGGCGTAG
Gene >Ophun1|260
ATGCCTCGGCTACCCGGGGCGAGGAGTCTGAAGCTCCTCAGATTGGCAGCCTCAACTCCCCGACCGGCGACGGCG
ACTTGCACCTTAACGACGACGAGCTCGGCACGGGGCGAGACCACCTCGTGGGTGCGCAGGAAGCTCTGGCGTAGC
GAACCACCCGGTCCCGAAGACCCCTACACTCAACGGTCAGAGGCTACCCAACCGGCTCCGGACACGGAGGAGACG
ACAAAGCCGGCACGAGTAGCTCGGGATAACACGCCGAAATCGATCAGGCGATCGCGTCTTATCGTACCTCCGAGG
CGGACCGAAGCAGCCACCCCGGAGCAGGCGAAGGAGCGGGATCCGAATTACGTGCCGGCCGAAGATGGAAAGGAC
CTGGAGCTGATTGCGACGCTCGATAATTGGTGGCAGCGGCCGGGCCACTGGGGCGAGGAGAGCAAGTTCAAGGGC
TTCGGGAACTCTACCATCGTGACGAATCGCGCCGTCATCGAAGCCACACTTTGCAGGGCTTTCTTCGAGGTCACT
GCTCTGCAGCAGACGGGGCATTTTGCCGAGTGGATGGCCAAGCCGTGGTACGTGGGCGGCAAGAAGGCACTTCGT
CTGATACTCGAGACCAAGTTTCCGGCCAAGGACACGACACTGCACAATTTCAACGCCAGTCACATCTCACAACAT
GTCCGGGGTACGGCCGATAGGTCTGAGGATGACGAGACTCATCGCATGTCGGTGGAGGAGGCCCAGGAAGCCATC
AAGCAGTGGGGTAGCAAGATGCGTGAGATCCAGCTCAGCGACGAAGCCAAGTTTGCGGTACGACATGTTCTCTCC
GTGCGGTTCCTTATCGAGACGCCCAGTATGCTGACTCCTAAACAAAGATCCGCAAGCGTGTCTACCAACTCACGG
GCAATCTCATCGCCGACTCCAAGCTGGGAGCTTCCAGGACGCTGCGTGACTTGCTACTCGTGACTGGAAAAGAGC
CCAAGCCGATGCGACTGACCGTGGAGCTACGCGAGCGCGGAGAACTAGATAGCCTGCCCAACGTGACGGTGCACA
AACAGAGGGTCGGCATCATCACCAAGGAGACTAATCTCGGGCGCTGGAAGTTGATTCAGCAGGAGCTCGGCAAGC
GCGGTCTTCCTGAACGGGGTCCGGCGAATGCTTCGGGCCTGGTCGAGGCAAAGTGGTTGTCGGGTAGGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail