Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|26
Gene name
LocationContig_1:63596..65645
Strand-
Gene length (bp)2049
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 218 389 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 243 397 2.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 222 413 3.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 258 445 4.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 218 422 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 218 389 1.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 243 397 2.0E-10
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 222 413 3.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 258 445 4.0E-08
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 218 422 5.0E-07
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 223 348 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2064
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5540
Ophiocordyceps australis map64 (Brazil) OphauB2|3771
Ophiocordyceps camponoti-floridani Ophcf2|04765
Ophiocordyceps camponoti-rufipedis Ophun1|26 (this protein)
Ophiocordyceps kimflemingae Ophio5|5744
Ophiocordyceps subramaniannii Hirsu2|2380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|26
MPEEEDSYPFDDNNITDEEPVYEGDDYGLSPSDSASAVNERPPSRPRSGRSAARRQQRISRQEAQYAPVNSPSVE
SPDDFAGGYYGQPFQSMPAPRGGGGGGGGGYYNGRGHALPGYNHASHYMTGFHAGSQMVPYNYGPNPFTPMSNHS
SGASYFGAEPRPLYEVMPYQHNYYNPQQCLAPHMQQLSMAPGQAPATDVAPAQPASPAPPKEPPVDIEKIKREAE
DAARKLQEDRQKAINDQLEREAQIRKDAEENFQKRLEDARKQHEEAQKEIARAKAEADRAAVERIQAEKKAEEER
SRLQAEEMKRAEEKAIREYEAKAKAEEEKKKRELEERIRIEEAAKAQVHAILKAEAEAKAAAEKKAAEDADRLKL
IQEEAKLKAEIEAKAKVEAEKEAAKKAAEDEAAAKKEQEALKKRIVDEAKAKFIEEASKKTEKGIINFKDAVGRK
FNFPFALVKTWAGMEELIKQAFLHVEIIGPHVQEGHYDLTGPNGEIILPSIWEKVIQPDWNISMTMWPVEKRPPL
GGPKPLFRGRGGPAMPPPPPMGPPGMEPPPDWHPDRRRHSHMPNIEIVDMGPPPKSRKPTAKKKPAGVFNFFAAT
SKPPPKKK*
Coding >Ophun1|26
ATGCCCGAGGAAGAGGACTCCTACCCATTCGACGACAACAACATAACCGACGAGGAACCGGTATACGAAGGCGAC
GACTACGGACTCTCTCCCTCCGACTCTGCTTCCGCCGTCAACGAACGGCCCCCGTCGCGTCCCCGAAGCGGCAGG
AGCGCGGCTCGTCGACAACAACGAATTTCTCGACAGGAGGCGCAATACGCCCCGGTAAACTCGCCCAGCGTGGAG
TCCCCCGATGATTTCGCCGGCGGCTACTACGGCCAGCCGTTCCAGTCTATGCCCGCCCCCCGCGGTGGTGGCGGT
GGTGGAGGTGGCGGCTACTACAACGGGCGTGGCCATGCTCTGCCTGGGTACAACCATGCCAGCCATTACATGACG
GGATTTCACGCCGGCAGCCAGATGGTCCCCTACAACTATGGTCCGAACCCTTTCACTCCCATGAGCAACCACTCG
AGCGGCGCGAGCTATTTCGGGGCTGAGCCACGGCCCTTGTATGAGGTGATGCCCTACCAGCATAACTACTACAAC
CCGCAGCAGTGCTTGGCCCCCCATATGCAACAGCTTTCAATGGCTCCGGGCCAGGCTCCGGCCACGGATGTGGCG
CCTGCGCAGCCGGCCAGTCCGGCACCCCCGAAGGAGCCTCCGGTGGACATTGAAAAGATTAAGCGTGAAGCCGAG
GACGCTGCCCGGAAGCTGCAAGAAGATAGGCAGAAGGCCATCAACGATCAGCTCGAGCGGGAGGCGCAGATACGC
AAAGATGCCGAGGAAAACTTCCAGAAGCGGCTGGAGGATGCGAGGAAGCAGCATGAGGAAGCGCAGAAGGAAATT
GCGCGCGCCAAGGCCGAGGCCGATCGGGCTGCCGTGGAAAGGATCCAAGCCGAGAAGAAGGCTGAGGAGGAACGG
TCACGTCTTCAGGCTGAAGAGATGAAGCGTGCCGAGGAAAAGGCCATTCGAGAGTACGAGGCCAAGGCCAAGGCG
GAGGAAGAGAAAAAGAAGAGGGAGCTGGAGGAGCGCATCAGGATTGAGGAAGCTGCAAAGGCTCAGGTCCACGCC
ATCTTAAAGGCCGAGGCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAAGACGCTGACCGACTGAAGCTG
ATACAGGAGGAAGCCAAGCTCAAGGCCGAGATCGAAGCAAAGGCCAAGGTCGAGGCCGAAAAAGAGGCAGCCAAG
AAGGCAGCCGAGGACGAAGCGGCAGCCAAGAAAGAACAGGAAGCTCTGAAGAAGCGAATCGTCGATGAGGCGAAA
GCAAAGTTCATCGAGGAAGCGTCCAAGAAGACGGAGAAGGGAATCATCAACTTCAAGGATGCGGTCGGCAGAAAG
TTTAACTTTCCCTTTGCTCTCGTCAAGACTTGGGCGGGTATGGAGGAGCTCATCAAGCAGGCCTTCCTCCACGTC
GAGATCATCGGACCGCACGTTCAAGAGGGCCATTACGACTTGACCGGGCCCAACGGCGAGATCATTCTCCCCTCC
ATATGGGAAAAGGTGATACAGCCGGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGACCGCCGCTG
GGGGGTCCCAAGCCCTTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCCGGC
ATGGAGCCGCCTCCGGATTGGCACCCGGACAGGCGGCGACATTCGCATATGCCCAACATCGAAATCGTCGACATG
GGACCGCCCCCCAAGTCGAGAAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTTAACTTCTTCGCCGCCACT
TCGAAGCCACCACCCAAGAAAAAGTGA
Transcript >Ophun1|26
ATGCCCGAGGAAGAGGACTCCTACCCATTCGACGACAACAACATAACCGACGAGGAACCGGTATACGAAGGCGAC
GACTACGGACTCTCTCCCTCCGACTCTGCTTCCGCCGTCAACGAACGGCCCCCGTCGCGTCCCCGAAGCGGCAGG
AGCGCGGCTCGTCGACAACAACGAATTTCTCGACAGGAGGCGCAATACGCCCCGGTAAACTCGCCCAGCGTGGAG
TCCCCCGATGATTTCGCCGGCGGCTACTACGGCCAGCCGTTCCAGTCTATGCCCGCCCCCCGCGGTGGTGGCGGT
GGTGGAGGTGGCGGCTACTACAACGGGCGTGGCCATGCTCTGCCTGGGTACAACCATGCCAGCCATTACATGACG
GGATTTCACGCCGGCAGCCAGATGGTCCCCTACAACTATGGTCCGAACCCTTTCACTCCCATGAGCAACCACTCG
AGCGGCGCGAGCTATTTCGGGGCTGAGCCACGGCCCTTGTATGAGGTGATGCCCTACCAGCATAACTACTACAAC
CCGCAGCAGTGCTTGGCCCCCCATATGCAACAGCTTTCAATGGCTCCGGGCCAGGCTCCGGCCACGGATGTGGCG
CCTGCGCAGCCGGCCAGTCCGGCACCCCCGAAGGAGCCTCCGGTGGACATTGAAAAGATTAAGCGTGAAGCCGAG
GACGCTGCCCGGAAGCTGCAAGAAGATAGGCAGAAGGCCATCAACGATCAGCTCGAGCGGGAGGCGCAGATACGC
AAAGATGCCGAGGAAAACTTCCAGAAGCGGCTGGAGGATGCGAGGAAGCAGCATGAGGAAGCGCAGAAGGAAATT
GCGCGCGCCAAGGCCGAGGCCGATCGGGCTGCCGTGGAAAGGATCCAAGCCGAGAAGAAGGCTGAGGAGGAACGG
TCACGTCTTCAGGCTGAAGAGATGAAGCGTGCCGAGGAAAAGGCCATTCGAGAGTACGAGGCCAAGGCCAAGGCG
GAGGAAGAGAAAAAGAAGAGGGAGCTGGAGGAGCGCATCAGGATTGAGGAAGCTGCAAAGGCTCAGGTCCACGCC
ATCTTAAAGGCCGAGGCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAAGACGCTGACCGACTGAAGCTG
ATACAGGAGGAAGCCAAGCTCAAGGCCGAGATCGAAGCAAAGGCCAAGGTCGAGGCCGAAAAAGAGGCAGCCAAG
AAGGCAGCCGAGGACGAAGCGGCAGCCAAGAAAGAACAGGAAGCTCTGAAGAAGCGAATCGTCGATGAGGCGAAA
GCAAAGTTCATCGAGGAAGCGTCCAAGAAGACGGAGAAGGGAATCATCAACTTCAAGGATGCGGTCGGCAGAAAG
TTTAACTTTCCCTTTGCTCTCGTCAAGACTTGGGCGGGTATGGAGGAGCTCATCAAGCAGGCCTTCCTCCACGTC
GAGATCATCGGACCGCACGTTCAAGAGGGCCATTACGACTTGACCGGGCCCAACGGCGAGATCATTCTCCCCTCC
ATATGGGAAAAGGTGATACAGCCGGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGACCGCCGCTG
GGGGGTCCCAAGCCCTTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCCGGC
ATGGAGCCGCCTCCGGATTGGCACCCGGACAGGCGGCGACATTCGCATATGCCCAACATCGAAATCGTCGACATG
GGACCGCCCCCCAAGTCGAGAAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTTAACTTCTTCGCCGCCACT
TCGAAGCCACCACCCAAGAAAAAGTGA
Gene >Ophun1|26
ATGCCGTGAGTTTTTTTATTATCCTCTCCGTCCTTTGAGAGGGGGCGTGCATGTCGCAGTCTCACTCGCCGTCTC
AACCCACTACCACTGACCAGACTATTCCGAAGACCGAACAGGACCCCGATACAACCCGGTGTCGAGAGTTCACGC
TCGACTTCCCATCCAAGCGAGGAAGAGGACTCCTACCCATTCGACGACAACAACATAACCGACGAGGAACCGGTA
TACGAAGGCGACGACTACGGACTCTCTCCCTCCGACTCTGCTTCCGCCGTCAACGAACGGCCCCCGTCGCGTCCC
CGAAGCGGCAGGAGCGCGGCTCGTCGACAACAACGAATTTCTCGACAGGAGGCGCAATACGCCCCGGTAAACTCG
CCCAGCGTGGAGTCCCCCGATGATTTCGCCGGCGGCTACTACGGCCAGCCGTTCCAGTCTATGCCCGCCCCCCGC
GGTGGTGGCGGTGGTGGAGGTGGCGGCTACTACAACGGGCGTGGCCATGCTCTGCCTGGGTACAACCATGCCAGC
CATTACATGACGGGATTTCACGCCGGCAGCCAGATGGTCCCCTACAACTATGGTCCGAACCCTTTCACTCCCATG
AGCAACCACTCGAGCGGCGCGAGCTATTTCGGGGCTGAGCCACGGCCCTTGTATGAGGTGATGCCCTACCAGCAT
AACTACTACAACCCGCAGCAGTGCTTGGCCCCCCATATGCAACAGCTTTCAATGGCTCCGGGCCAGGCTCCGGCC
ACGGATGTGGCGCCTGCGCAGCCGGCCAGTCCGGCACCCCCGAAGGAGCCTCCGGTGGACATTGAAAAGATTAAG
CGTGAAGCCGAGGACGCTGCCCGGAAGCTGCAAGAAGATAGGCAGAAGGCCATCAACGATCAGCTCGAGCGGGAG
GCGCAGATACGCAAAGATGCCGAGGAAAACTTCCAGAAGCGGCTGGAGGATGCGAGGAAGCAGCATGAGGAAGCG
CAGAAGGAAATTGCGCGCGCCAAGGCCGAGGCCGATCGGGCTGCCGTGGAAAGGATCCAAGCCGAGAAGAAGGCT
GAGGAGGAACGGTCACGTCTTCAGGCTGAAGAGATGAAGCGTGCCGAGGAAAAGGCCATTCGAGAGTACGAGGCC
AAGGCCAAGGCGGAGGAAGAGAAAAAGAAGAGGGAGCTGGAGGAGCGCATCAGGATTGAGGAAGCTGCAAAGGCT
CAGGTCCACGCCATCTTAAAGGCCGAGGCAGAGGCCAAGGCGGCGGCCGAGAAGAAGGCTGCTGAAGACGCTGAC
CGACTGAAGCTGATACAGGAGGAAGCCAAGCTCAAGGCCGAGATCGAAGCAAAGGCCAAGGTCGAGGCCGAAAAA
GAGGCAGCCAAGAAGGCAGCCGAGGACGAAGCGGCAGCCAAGAAAGAACAGGAAGCTCTGAAGAAGCGAATCGTC
GATGAGGCGAAAGCAAAGTTCATCGAGGAAGCGTCCAAGAAGACGGAGAAGGGAATCATCAACTTCAAGGATGCG
GTCGGCAGAAAGTTTAACTTTCCCTTTGCTCTCGTCAAGACTTGGGCGGTACGTGTGTCGTAACTTGACCTCTCA
CGGGCGTGTGCTGACCTGAATGAATTCGTGCAGGGTATGGAGGAGCTCATCAAGCAGGCCTTCCTCCACGTCGAG
ATCATCGGACCGCACGTTCAAGAGGGCCATTACGACTTGACCGGGCCCAACGGCGAGATCATTCTCCCCTCCATA
TGGGAAAAGGTGATACAGCCGGACTGGAACATCAGCATGACGATGTGGCCGGTCGAGAAGAGACCGCCGCTGGGG
GGTCCCAAGCCCTTGTTCCGGGGCCGAGGAGGACCGGCGATGCCTCCGCCGCCGCCCATGGGCCCGCCCGGCATG
GAGCCGCCTCCGGATTGGCACCCGGACAGGCGGCGACATTCGCATATGCCCAACATCGAAATCGTCGACATGGGA
CCGCCCCCCAAGTCGAGAAAGCCGACAGCCAAGAAGAAGCCGGCCGGCGTGTTTAACTTCTTCGCCGCCACTTCG
AAGCCACCACCCAAGAAAAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail