Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2598
Gene name
LocationContig_232:14337..19468
Strand+
Gene length (bp)5131
Transcript length (bp)2733
Coding sequence length (bp)2733
Protein length (aa) 911

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 2.2E-15 16 71
PF04193 PQ-loop PQ loop repeat 3.4E-14 194 239
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 2.9E-23 394 501

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM7|TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim23 PE=3 SV=1 335 507 1.0E-54
sp|P32897|TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 349 507 6.0E-48
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 7 239 2.0E-41
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 30 239 6.0E-32
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 1 239 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USM7|TIM23_SCHPO Mitochondrial import inner membrane translocase subunit tim23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim23 PE=3 SV=1 335 507 1.0E-54
sp|P32897|TIM23_YEAST Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 349 507 6.0E-48
sp|P38279|YPQ3_YEAST Probable vacuolar amino acid transporter YPQ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTC2 PE=1 SV=1 7 239 2.0E-41
sp|Q12010|YPQ1_YEAST Probable vacuolar amino acid transporter YPQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ1 PE=1 SV=1 30 239 6.0E-32
sp|Q10482|STM1_SCHPO Seven transmembrane protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stm1 PE=1 SV=1 1 239 2.0E-19
sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans GN=laat-1 PE=1 SV=2 4 239 4.0E-16
sp|Q06328|YPQ2_YEAST Probable vacuolar amino acid transporter YPQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPQ2 PE=1 SV=1 14 239 5.0E-15
sp|Q6ZP29|LAAT1_HUMAN Lysosomal amino acid transporter 1 homolog OS=Homo sapiens GN=PQLC2 PE=1 SV=1 20 252 2.0E-11
sp|O35093|TIM23_RAT Mitochondrial import inner membrane translocase subunit Tim23 OS=Rattus norvegicus GN=Timm23 PE=2 SV=1 355 510 2.0E-09
sp|Q7T2P6|TIM23_DANRE Mitochondrial import inner membrane translocase subunit Tim23 OS=Danio rerio GN=timm23 PE=2 SV=1 355 510 2.0E-09
sp|Q6INU6|TIM23_XENLA Mitochondrial import inner membrane translocase subunit Tim23 OS=Xenopus laevis GN=timm23 PE=2 SV=1 355 516 1.0E-08
sp|Q5ZJX0|LAAT1_CHICK Lysosomal amino acid transporter 1 homolog OS=Gallus gallus GN=PQLC2 PE=2 SV=1 16 237 2.0E-08
sp|Q5SRD1|TI23B_HUMAN Putative mitochondrial import inner membrane translocase subunit Tim23B OS=Homo sapiens GN=TIMM23B PE=5 SV=2 355 488 3.0E-08
sp|Q5RDD0|TIM23_PONAB Mitochondrial import inner membrane translocase subunit Tim23 OS=Pongo abelii GN=TIMM23 PE=2 SV=1 355 510 3.0E-08
sp|O14925|TIM23_HUMAN Mitochondrial import inner membrane translocase subunit Tim23 OS=Homo sapiens GN=TIMM23 PE=1 SV=1 355 510 3.0E-08
sp|Q9WTQ8|TIM23_MOUSE Mitochondrial import inner membrane translocase subunit Tim23 OS=Mus musculus GN=Timm23 PE=1 SV=1 355 510 4.0E-08
sp|Q9LNQ1|TI231_ARATH Mitochondrial import inner membrane translocase subunit TIM23-1 OS=Arabidopsis thaliana GN=TIM23-1 PE=2 SV=1 352 491 7.0E-08
sp|Q5XH94|TIM23_XENTR Mitochondrial import inner membrane translocase subunit Tim23 OS=Xenopus tropicalis GN=timm23 PE=2 SV=1 355 501 2.0E-07
sp|A4IFL0|TIM23_BOVIN Mitochondrial import inner membrane translocase subunit Tim23 OS=Bos taurus GN=TIMM23 PE=2 SV=1 355 487 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 46 68 22
3 156 178 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2598
MAPLTPLFPVDAVAVSGICGAISIACWVVVFSPQIIQQFRQGNADGLSVQFIAIWLLGDVFNIAGAVLQGTMLAI
YYTLTDLVLLGQCFYYRGPRWRDDATPTSDMDDERTPLTSRAAAGETRPSDWTGLSPAVGHPAAEAAPEERRARS
GLLRTAAWNAIVIAMVFCAGIAGWLLNGRRRRGPGSGLEFDAAGQVFGYLCAVAYMASRVPQLLLNWRRKTTDGL
SMLFFLFACLGNATTEEEEEEEEEEEYDDEEDEEDNGNEERAYPNGRGLCCCVRPSIASMSSLWNALTDGSKQSQ
AQAHAAVQPRAVGQTSPGLAETDEPEPVRMPLSLTPGTDAYIHQSAFADPSLLHPLAGLDKPSLEYLTLDESALS
DLPGGQSILPSRGFTDDLCYGTGITYLTALSIGGAWGLQEGLRRSDGQPPKLRLNSVLNAVTRRGPFLGNSAGAV
AITYNCINSLIGHLRGKHAASNSVLAGALSGMVFKSTQGLRPMMISGGIVGSIAAVWAQHPVQEAIAMCLPCFPW
TWTQYEDPLDRMPAQHVWVRDGAAWKLVKTSPKTPRRLRSGDSLDSARQVRFEAEDSDGRAPSPKNRQPTSFPQV
GPPPVSGGLAQGWHTAADPTRSLGSGGPTTGLAFSPFLNHFQLHPQPFIGNHHHHNIAMADYANAAPHPAGVNFQ
PPVPDNTFGPIPHLYVPRFDTVPVGQPNLHYVPLVAYPPRVDHTPATYSVMVPQTLYSPHYNYHASTPTQTGPPG
TIPGTYAAGHPGYVYGPQHYPAQAQQPLMINGQAYVPVGGAAAGAPGQPYPPQMMPGGYAMVNGAPVPFMTPGND
GKAPDVGGPGRTPNEEMLRQIQFAHDNKLFEPQDFKPGDDDPSRFYYVRELDGNWTQRNRFTIDTLSCRWYVTDE
GWFYAVRLPD*
Coding >Ophun1|2598
ATGGCGCCTCTGACGCCGCTGTTTCCCGTTGACGCCGTGGCCGTCTCCGGAATCTGCGGGGCTATATCCATCGCG
TGTTGGGTCGTCGTCTTCTCGCCGCAGATCATTCAACAGTTCCGGCAGGGAAACGCTGATGGCTTGTCGGTCCAG
TTCATCGCCATATGGCTGCTGGGAGACGTCTTCAACATCGCGGGGGCCGTCCTTCAGGGGACGATGCTGGCGATA
TACTATACCTTGACGGACCTGGTGCTGTTGGGCCAGTGCTTCTACTACCGCGGACCGCGATGGCGCGACGACGCG
ACCCCGACGTCGGACATGGATGACGAGCGGACACCGTTGACAAGTCGAGCGGCGGCGGGCGAGACGCGGCCTTCG
GACTGGACAGGCCTGTCGCCTGCCGTCGGCCATCCCGCGGCCGAAGCAGCCCCGGAAGAGCGGCGGGCGCGCTCG
GGCCTGCTACGGACAGCCGCATGGAACGCAATCGTCATCGCCATGGTCTTTTGCGCCGGGATCGCCGGCTGGCTC
CTCAACGGGCGGCGCAGACGCGGGCCGGGTAGCGGACTCGAGTTCGACGCGGCGGGCCAGGTCTTCGGCTACCTG
TGCGCGGTGGCATACATGGCGTCGCGCGTGCCGCAGCTGCTGCTCAACTGGCGGCGCAAGACGACGGATGGCCTG
AGCATGCTGTTCTTTCTGTTTGCTTGCTTGGGGAACGCAACGACGGAGGAGGAGGAGGAGGAGGAAGAGGAGGAG
GAGTATGACGACGAGGAAGACGAGGAAGACAATGGCAACGAGGAACGTGCTTATCCCAACGGTCGTGGCCTCTGC
TGCTGCGTCCGCCCTTCCATCGCCTCCATGTCGTCACTCTGGAACGCCCTTACGGACGGCAGCAAGCAGTCACAG
GCCCAGGCCCATGCGGCAGTTCAGCCTCGGGCCGTGGGCCAGACATCGCCGGGCCTGGCCGAGACCGACGAGCCG
GAGCCGGTCAGAATGCCACTGTCACTGACGCCGGGGACGGATGCCTACATCCATCAGTCGGCCTTTGCCGATCCG
TCGCTGCTGCATCCCCTCGCCGGCCTCGACAAGCCGTCGCTCGAATACCTGACGCTCGACGAGTCGGCGCTGTCC
GACCTACCGGGCGGTCAGTCGATTCTGCCGTCGCGGGGCTTCACCGATGATCTCTGCTACGGCACTGGCATTACA
TATCTGACGGCGCTTTCGATTGGTGGTGCCTGGGGTCTGCAGGAGGGGCTGCGCAGGTCTGATGGACAGCCGCCC
AAGTTGCGCCTCAACTCGGTCCTCAACGCCGTGACCAGGCGAGGGCCTTTTCTCGGGAATTCGGCTGGTGCGGTG
GCCATTACTTATAACTGCATCAACTCGCTCATAGGTCATCTGCGCGGCAAGCACGCTGCTTCGAATAGCGTCTTG
GCCGGCGCGTTGAGCGGCATGGTCTTTAAGAGTACGCAGGGGTTGCGTCCCATGATGATCTCTGGAGGCATTGTC
GGGTCTATTGCCGCTGTCTGGGCTCAGCATCCCGTCCAAGAAGCCATCGCCATGTGCCTGCCCTGCTTCCCCTGG
ACGTGGACGCAGTACGAAGATCCGCTGGATCGGATGCCGGCTCAGCACGTCTGGGTTCGTGACGGCGCAGCGTGG
AAGTTGGTCAAGACGTCGCCCAAGACACCTCGTCGTCTCCGATCCGGAGACAGCCTCGACAGCGCGCGTCAGGTG
CGTTTCGAGGCGGAAGACTCCGACGGCCGGGCTCCCTCTCCCAAGAACCGGCAGCCGACGAGCTTTCCCCAGGTC
GGCCCACCGCCCGTTTCGGGGGGCCTGGCCCAGGGCTGGCACACGGCTGCTGACCCTACTCGCAGCCTTGGTAGT
GGCGGTCCGACAACTGGCCTCGCCTTTTCACCTTTTCTCAACCACTTCCAACTTCATCCGCAACCTTTCATCGGA
AATCATCACCATCATAACATCGCCATGGCCGACTACGCCAACGCTGCGCCTCACCCTGCTGGTGTCAACTTCCAG
CCGCCTGTGCCCGACAACACCTTTGGGCCCATCCCGCACCTTTACGTGCCTCGTTTCGATACCGTTCCGGTCGGT
CAACCCAACCTTCATTATGTTCCCCTCGTCGCGTACCCTCCTCGCGTCGATCATACGCCTGCCACCTACTCCGTC
ATGGTGCCCCAGACGCTCTATTCGCCTCACTACAACTATCATGCAAGTACGCCGACTCAGACTGGTCCTCCTGGA
ACCATCCCTGGCACCTATGCGGCTGGTCATCCCGGCTATGTTTACGGACCGCAGCACTACCCTGCTCAGGCTCAG
CAGCCGCTCATGATCAACGGCCAGGCCTACGTCCCCGTCGGAGGAGCTGCCGCCGGTGCTCCGGGACAGCCCTAC
CCTCCGCAGATGATGCCGGGTGGCTATGCCATGGTCAACGGGGCTCCGGTCCCTTTCATGACTCCAGGTAATGAT
GGAAAAGCCCCTGACGTCGGAGGTCCTGGCCGCACGCCCAATGAGGAAATGTTGCGTCAAATCCAGTTCGCCCAT
GACAACAAGCTCTTTGAGCCCCAGGACTTTAAGCCTGGCGATGACGATCCAAGCCGTTTCTACTACGTTCGAGAA
CTTGACGGTAATTGGACACAGCGCAATCGGTTCACTATTGATACGCTTTCCTGCCGCTGGTATGTCACCGACGAG
GGCTGGTTCTACGCCGTCCGCCTTCCGGACTAA
Transcript >Ophun1|2598
ATGGCGCCTCTGACGCCGCTGTTTCCCGTTGACGCCGTGGCCGTCTCCGGAATCTGCGGGGCTATATCCATCGCG
TGTTGGGTCGTCGTCTTCTCGCCGCAGATCATTCAACAGTTCCGGCAGGGAAACGCTGATGGCTTGTCGGTCCAG
TTCATCGCCATATGGCTGCTGGGAGACGTCTTCAACATCGCGGGGGCCGTCCTTCAGGGGACGATGCTGGCGATA
TACTATACCTTGACGGACCTGGTGCTGTTGGGCCAGTGCTTCTACTACCGCGGACCGCGATGGCGCGACGACGCG
ACCCCGACGTCGGACATGGATGACGAGCGGACACCGTTGACAAGTCGAGCGGCGGCGGGCGAGACGCGGCCTTCG
GACTGGACAGGCCTGTCGCCTGCCGTCGGCCATCCCGCGGCCGAAGCAGCCCCGGAAGAGCGGCGGGCGCGCTCG
GGCCTGCTACGGACAGCCGCATGGAACGCAATCGTCATCGCCATGGTCTTTTGCGCCGGGATCGCCGGCTGGCTC
CTCAACGGGCGGCGCAGACGCGGGCCGGGTAGCGGACTCGAGTTCGACGCGGCGGGCCAGGTCTTCGGCTACCTG
TGCGCGGTGGCATACATGGCGTCGCGCGTGCCGCAGCTGCTGCTCAACTGGCGGCGCAAGACGACGGATGGCCTG
AGCATGCTGTTCTTTCTGTTTGCTTGCTTGGGGAACGCAACGACGGAGGAGGAGGAGGAGGAGGAAGAGGAGGAG
GAGTATGACGACGAGGAAGACGAGGAAGACAATGGCAACGAGGAACGTGCTTATCCCAACGGTCGTGGCCTCTGC
TGCTGCGTCCGCCCTTCCATCGCCTCCATGTCGTCACTCTGGAACGCCCTTACGGACGGCAGCAAGCAGTCACAG
GCCCAGGCCCATGCGGCAGTTCAGCCTCGGGCCGTGGGCCAGACATCGCCGGGCCTGGCCGAGACCGACGAGCCG
GAGCCGGTCAGAATGCCACTGTCACTGACGCCGGGGACGGATGCCTACATCCATCAGTCGGCCTTTGCCGATCCG
TCGCTGCTGCATCCCCTCGCCGGCCTCGACAAGCCGTCGCTCGAATACCTGACGCTCGACGAGTCGGCGCTGTCC
GACCTACCGGGCGGTCAGTCGATTCTGCCGTCGCGGGGCTTCACCGATGATCTCTGCTACGGCACTGGCATTACA
TATCTGACGGCGCTTTCGATTGGTGGTGCCTGGGGTCTGCAGGAGGGGCTGCGCAGGTCTGATGGACAGCCGCCC
AAGTTGCGCCTCAACTCGGTCCTCAACGCCGTGACCAGGCGAGGGCCTTTTCTCGGGAATTCGGCTGGTGCGGTG
GCCATTACTTATAACTGCATCAACTCGCTCATAGGTCATCTGCGCGGCAAGCACGCTGCTTCGAATAGCGTCTTG
GCCGGCGCGTTGAGCGGCATGGTCTTTAAGAGTACGCAGGGGTTGCGTCCCATGATGATCTCTGGAGGCATTGTC
GGGTCTATTGCCGCTGTCTGGGCTCAGCATCCCGTCCAAGAAGCCATCGCCATGTGCCTGCCCTGCTTCCCCTGG
ACGTGGACGCAGTACGAAGATCCGCTGGATCGGATGCCGGCTCAGCACGTCTGGGTTCGTGACGGCGCAGCGTGG
AAGTTGGTCAAGACGTCGCCCAAGACACCTCGTCGTCTCCGATCCGGAGACAGCCTCGACAGCGCGCGTCAGGTG
CGTTTCGAGGCGGAAGACTCCGACGGCCGGGCTCCCTCTCCCAAGAACCGGCAGCCGACGAGCTTTCCCCAGGTC
GGCCCACCGCCCGTTTCGGGGGGCCTGGCCCAGGGCTGGCACACGGCTGCTGACCCTACTCGCAGCCTTGGTAGT
GGCGGTCCGACAACTGGCCTCGCCTTTTCACCTTTTCTCAACCACTTCCAACTTCATCCGCAACCTTTCATCGGA
AATCATCACCATCATAACATCGCCATGGCCGACTACGCCAACGCTGCGCCTCACCCTGCTGGTGTCAACTTCCAG
CCGCCTGTGCCCGACAACACCTTTGGGCCCATCCCGCACCTTTACGTGCCTCGTTTCGATACCGTTCCGGTCGGT
CAACCCAACCTTCATTATGTTCCCCTCGTCGCGTACCCTCCTCGCGTCGATCATACGCCTGCCACCTACTCCGTC
ATGGTGCCCCAGACGCTCTATTCGCCTCACTACAACTATCATGCAAGTACGCCGACTCAGACTGGTCCTCCTGGA
ACCATCCCTGGCACCTATGCGGCTGGTCATCCCGGCTATGTTTACGGACCGCAGCACTACCCTGCTCAGGCTCAG
CAGCCGCTCATGATCAACGGCCAGGCCTACGTCCCCGTCGGAGGAGCTGCCGCCGGTGCTCCGGGACAGCCCTAC
CCTCCGCAGATGATGCCGGGTGGCTATGCCATGGTCAACGGGGCTCCGGTCCCTTTCATGACTCCAGGTAATGAT
GGAAAAGCCCCTGACGTCGGAGGTCCTGGCCGCACGCCCAATGAGGAAATGTTGCGTCAAATCCAGTTCGCCCAT
GACAACAAGCTCTTTGAGCCCCAGGACTTTAAGCCTGGCGATGACGATCCAAGCCGTTTCTACTACGTTCGAGAA
CTTGACGGTAATTGGACACAGCGCAATCGGTTCACTATTGATACGCTTTCCTGCCGCTGGTATGTCACCGACGAG
GGCTGGTTCTACGCCGTCCGCCTTCCGGACTAA
Gene >Ophun1|2598
ATGGCGCCTCTGACGCCGCTGTTTCCCGTTGACGCCGTGGCCGTCTCCGGAATCTGCGGGTATGGATGAGTCTTC
GCTTTGGCTGGCGGATGCGGACTGACGCGTATCGGTTCTAGGGCTATATCCATCGCGTGTTGGGGTCAGTGACGC
GCCCAGGCTCGAGTGCGTGTTTAGAACGACGACTGACTATGATGGAGTAGTCGTCGTCTTCTCGCCGCAGATCAT
TCAACAGTTCCGGCAGGGAAACGCTGATGGCTTGTCGGTCCAGTTCATCGCCATATGGCTGCTGGGAGACGTCTT
CAACATCGCGGGGGCCGTCCTTCAGGGGGTTCTCCCGACCATGGCACGACGCCTAGTCCTTGAAGAGTGGCGGTT
CGAGGGCTGACGTGAGGGACAGACGATGCTGGCGATATACTATACCTTGACGGACCTGGTGCTGTTGGGCCAGTG
CTTCTACTACCGCGGACCGCGATGGCGCGACGACGCGACCCCGACGTCGGACATGGATGACGAGCGGACACCGTT
GACAAGTCGAGCGGCGGCGGGCGAGACGCGGCCTTCGGACTGGACAGGCCTGTCGCCTGCCGTCGGCCATCCCGC
GGCCGAAGCAGCCCCGGAAGAGCGGCGGGCGCGCTCGGGCCTGCTACGGACAGCCGCATGGAACGCAATCGTCAT
CGCCATGGTCTTTTGCGCCGGGATCGCCGGCTGGCTCCTCAACGGGCGGCGCAGACGCGGGCCGGGTAGCGGACT
CGAGTTCGACGCGGCGGGCCAGGTCTTCGGCTACCTGTGCGCGGTGGCATACATGGCGTCGCGCGTGCCGCAGCT
GCTGCTCAACTGGCGGCGCAAGACGACGGATGGCCTGAGCATGCTGTTCTTTCTGTTTGCTTGCTTGGGGAACGC
AACGTATGTGCTGTCCATTCTGTCGTATGAGCCGAGGGGTTGTGTCGATGGTTCGTGCAGCCCGGGGGCTGTGTA
TGGTCGACACGTGCTCGTGAACTTGAGCTGGTTGATGGGGAGTGCCGTGACGTTGTTGATGGACTTGGTTGTCTT
GGCGCAGCACTTGATTTATAGGACGGAGGAGGAGGAGGAGGAGGAAGAGGAGGAGGAGTATGACGACGAGGAAGA
CGAGGAAGACAATGGCAACGAGGAACGTGGTGGGAGGCGTTCGGCTGAAGATGACTGGGCGGGGAGACCTATACT
GCGGCGAGGAGAAACGAACGATCGGTGATGGCAAGCTGTGAGGTCCTGTAAAGTGCTGTCTCAGTCTGTATGTAA
TACCACCAGCTCAGACGATGTCTCGTCACAACGAGGCGAGCCCGGATCAAAGGTTCGGACTAACTGCCACATTAG
TCCGAAACCCGACTAACCCCACAAATCTTCCGGGCACCGCATAAAACCTCGACTCGACGGCCCCTCGCCTCTTCT
TCTTCTTCTTTTTCTCCCTACATCAGTAAGGGTTATTTCTACACCGTCAAGTGTTTTAATAATACCGAACGGCGG
CTCCGCGAAAGCGGCTTGCTGAGGGTTACTCGATATCTTCGCCGTGGGTTTCCTTCCGTTCCCGGCCTCCCAGAG
CAATGAGGACTGCCTTTCCTACCAGCCGTTGACGTCGTCGAGGTCTGCGACTGTGGGGTGGTTTCGACATGTTTG
GTGTAGGATTTAGCTGCGAATCTGCCGTGTGATTCATTCATAGATTGGACTCGTCAACCGGCGGTTGTGAGTTTC
TATGAATTTCCATAACGAAAACACCGTCTATTGTAGCCTGTAGATGATGGAAAACTGCCAGGCATCAAGATTTTC
CCAACCGTGAGTCTCTGCAAATTTTGACGCCCACCACCCTCCGTCCCAGCACGTGACATGCCACCCTCCCCGCAT
AGCCAATGCACGGACCACGCCCCTGGATATTTTTTTTTAAAACCACATCAGTCCCTTAGACATCGTCCGCAAATA
GCTTATCCCAACGGTCGTGGCCTCTGCTGCTGCGTCCGCCCTTCCATCGCCTCCATGTCGTCACTCTGGAACGCC
CTTACGGACGGCAGCAAGCAGTCACAGGCCCAGGCCCATGCGGCAGTTCAGCCTCGGGCCGTGGGCCAGACATCG
CCGGGCCTGGCCGAGACCGACGAGCCGGAGCCGGTCAGAATGCCACTGTCACTGACGCCGGGGACGGATGCCTAC
ATCCATCAGTCGGCCTTTGCCGATCCGTCGCTGCTGCATCCCCTCGCCGGCCTCGACAAGCCGTCGCTCGAATAC
CTGACGCTCGACGAGTCGGCGCTGTCCGACCTACCGGGCGGTCAGTCGATTCTGCCGTCGCGGGGCTTCACCGAT
GATCTCTGCTACGGCACTGGCATTACATATCTGACGGCGCTTTCGATTGGTGGTGCCTGGGGTCTGCAGGAGGGG
CTGCGCAGGTCTGATGGACAGCCGCCCAAGTTGCGCCTCAACTCGGTCCTCAACGCCGTGACCAGGCGAGGGCCT
TTTCTCGGGAATTCGGCTGGTGCGGTGGCCATTACTTATAACTGCATCAACTCGCTCATAGGTCATCTGCGCGGC
AAGCACGCTGCTTCGAATAGCGTCTTGGCCGGCGCGTTGAGCGGCATGGTCTTTAAGAGTACGCAGGGGTTGCGT
CCCATGATGATCTCTGGAGGCATTGTCGGGTCTATTGCCGCTGTCTGGGCTGTGAGTCTTGTGGTTCTCGTGATT
CATCTTTACGGTGACTGATGGATGATTCAAGATCTTTCGGCGAAGCGTGTTTCCCGTGCCGGATCGCAGTGCTCC
GATCACGACGATGTGATGGATCCTCGATGAATGAAGAATGCTGAAGCGATTCCTCTCATATTTTTGCCTTGAAAT
GACCATTTTTATTGGGAGGGAGGGAGGGTGGAAGGGGAGGGGGGACGTCATCTTGTACGAGCCGAGTGCTGAGCA
GCATCGGCCGATATCCCGTGAAAAGGCGTGTACATTAAGCCAATGGTCAGCGAGCATTAGATCGCTTAGGGAGTG
GCGTCTGGTTTACAATGGTCATGCAATTGGATTTGAATGTGTTGCTTTGTACTGGCTTCCTGTGGTGCTGTCAGG
GGTTGAGGGGATCAAGTGGTTGTGGTTGTCGGTTGGCCCTGCTGCCACGGTCCTCTCTACTACCCACCTCACAGA
CACAGGTGTTGATCTCGCCCGCACGAAAATCTACCTACAGGGGTTCTCCAACCGCCGGCCAGCTCAAGTCATCAA
CCGCAATCTCCTCGCCTCAACAGCAGCATCCCGTCCAAGAAGCCATCGCCATGTGCCTGCCCTGCTTCCCCTGGA
CGTGGACGCAGTACGAAGATCCGCTGGATCGGATGCCGGCTCAGCACGTCTGGGTTCGTGACGGCGCAGCGTGGA
AGTTGGTCAAGACGGTGAGTTGCGCGTTGCTGCGGCGCCGAGTGATGTGTTTTTTTTTTTCTCTTATTTTCTTTC
CTTCTCTCTTCTTCTCTCTTCTTCTCCCTCTGTGTTTTTTTTTTCCCACTGCCTCAGGTAGTCCTGATGCCCTGG
AAGAAAAAAAAAAAATCTGGGTCTCGCTGCCAGCTGGCAAGGCAAACGCCTCTCCCCTTAAAAACCCCTCCTCCC
ATCTTCACCTGCATTTTCTTCTTCCTCCTCCACCAACCTCCCCTTCCCCTGATATCCTCCCCCAACATCTCCTCC
GCCGCTGAGTCGAGCGTGCAACCCCCTTTCCTTTCTTCAGGCCTCGAGTCCCGGAGAGATATGCCATCAGCCCAA
GGCGAAGCTGTCAAGTCGCCCAAGACACCTCGTCGTCTCCGATCCGGAGACAGCCTCGACAGCGCGCGTCAGGTG
CGTTTCGAGGCGGAAGACTCCGACGGCCGGGCTCCCTCTCCCAAGAACCGGCAGCCGACGAGCTTTCCCCAGGTC
GGCCCACCGCCCGTTTCGGGGGGCCTGGCCCAGGGCTGGCACACGGCTGCTGACCCTACTCGCAGCCTTGGTAGT
GGCGGTCCGACAACTGGCCTCGCCTTTTCACCTTTTCTCAACCACTTCCAACTTCATCCGCAACCTTTCATCGGA
AATCATCACCATCATAACATCGCCATGGCCGACTACGCCAACGCTGCGCCTCACCCTGCTGGTGTCAACTTCCAG
CCGCCTGTGCCCGACAACACCTTTGGGCCCATCCCGCACCTTTACGTGCCTCGTTTCGATACCGTTCCGGTCGGT
CAACCCAACCTTCATTATGTTCCCCTCGTCGCGTACCCTCCTCGCGTCGATCATACGCCTGCCACCTACTCCGTC
ATGGTGCCCCAGACGCTCTATTCGCCTCACTACAACTATCATGCAAGTGTTATCACCGGCCGATCAGTCTTCGGC
CTCTTCCCTCACTTCCTGTTGATTAGTTTCTGCTGATTTCTCCCCCAGAAAACTTCCCAGAAAAGTTTCCCGGAT
TTGTCTTCGGAAAATTTCTCTTGTTTCTTTCTTTCTTGCCATCTTTCCCCCAAACAAGCATCTCTCTTCTTCTTC
GTCCATCTGCTCTGCCCTCACTGCCAAGCGGTTTACCCACACCCCATCACATCTCTTCCCTGCATCCTCATCATG
ACTTGGAGACACCATGTACTGACCGACTCGACTTTTGTTCTTGCAGACGCCGACTCAGACTGGTCCTCCTGGAAC
CATCCCTGGCACCTATGCGGCTGGTCATCCCGGCTATGTTTACGGACCGCAGCACTACCCTGCTCAGGCTCAGCA
GCCGCTCATGATCAACGGCCAGGCCTACGTCCCCGTCGGAGGAGCTGCCGCCGGTGCTCCGGGACAGCCCTACCC
TCCGCAGATGATGCCGGGTGGCTATGCCATGGTCAACGGGGCTCCGGTCCCTTTCATGACTCCAGGTAATGATGG
AAAAGCCCCTGACGTCGGAGGTCCTGGCCGCACGCCCAATGAGGAAATGTTGCGTCAAATCCAGTTCGCCCATGA
CAACAAGCTCTTTGAGCCCCAGGACTTTAAGCCTGGCGATGACGATCCAAGCCGTTTCTACTACGTTCGAGAACT
TGACGGTAATTGGACACAGCGCAATCGGTTCACTATTGATACGCTTTCCTGCCGCTGGTATGTCACCGACGAGGG
CTGGTTCTACGCCGTCCGCCTTCCGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail