Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2595
Gene name
LocationContig_232:7665..8639
Strand-
Gene length (bp)974
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08538 DUF1749 Protein of unknown function (DUF1749) 6.2E-80 7 287
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.5E-10 67 280
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.4E-07 84 272

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Y8|YKM6_SCHPO UPF0613 protein PB24D3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.06c PE=3 SV=1 9 289 2.0E-41

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2595
MASSDKPFPVLVHPYRSTSRGTCAYELGNGSARNAIIFIGGLSDGPHTTPYIRRVAGRLQEANDLSYSVFEIRLR
SAFTGFGTASLKDDVEDIAALVNYLRGLGREKIVLFGHSTGCQDCMEYVKQSSPPVDGFILQAPVSDREGLDLFE
PDFKTTLDLAKSWIAQGKANDCLPRNMVPSSLGAPVSAYRLYSLWAKGGDDDYFSSDLDDETVLRVWGRFTKPVL
VLHSERDEFVPQQIDQAGLNAKYRGANSMVSGLSGLIPGTGHTVLDEEARQWVAKRVDEFLRTLG*
Coding >Ophun1|2595
ATGGCTTCGAGCGACAAGCCATTCCCCGTGCTCGTGCACCCGTACCGCTCTACGTCTAGGGGCACCTGCGCCTAT
GAGCTGGGAAACGGGTCGGCACGCAATGCCATCATCTTCATAGGCGGCCTCTCGGACGGTCCGCACACGACGCCA
TATATCCGGAGGGTAGCGGGACGGCTTCAAGAGGCCAATGACCTCAGCTACTCCGTGTTTGAGATCCGACTGAGG
AGCGCATTTACCGGATTTGGGACGGCCAGTCTAAAGGATGACGTGGAGGATATAGCGGCGCTTGTCAACTATCTC
CGCGGTCTGGGCAGGGAGAAGATTGTCTTATTTGGCCATTCGACCGGGTGCCAAGACTGCATGGAATACGTCAAG
CAGAGCAGCCCGCCCGTGGACGGCTTTATCCTACAGGCACCGGTATCGGACAGGGAAGGATTGGATCTGTTTGAG
CCAGACTTTAAGACGACGCTGGATCTGGCCAAGAGTTGGATCGCGCAAGGCAAGGCGAACGACTGCCTTCCTCGC
AATATGGTTCCCAGCTCGCTTGGGGCCCCTGTCTCAGCCTACAGGCTGTACTCGCTTTGGGCCAAGGGGGGAGAC
GACGACTACTTCTCTTCGGATCTAGACGACGAGACGGTCCTTCGGGTCTGGGGCAGATTCACAAAGCCGGTCTTG
GTGCTGCATTCGGAGCGGGACGAGTTTGTGCCGCAGCAGATCGACCAGGCAGGGTTGAACGCCAAGTACCGTGGC
GCGAATTCGATGGTCAGCGGGCTCTCTGGGCTGATTCCCGGCACGGGTCATACCGTGTTGGACGAGGAGGCTCGG
CAATGGGTGGCGAAGCGGGTGGACGAGTTTCTGCGGACGCTGGGATAG
Transcript >Ophun1|2595
ATGGCTTCGAGCGACAAGCCATTCCCCGTGCTCGTGCACCCGTACCGCTCTACGTCTAGGGGCACCTGCGCCTAT
GAGCTGGGAAACGGGTCGGCACGCAATGCCATCATCTTCATAGGCGGCCTCTCGGACGGTCCGCACACGACGCCA
TATATCCGGAGGGTAGCGGGACGGCTTCAAGAGGCCAATGACCTCAGCTACTCCGTGTTTGAGATCCGACTGAGG
AGCGCATTTACCGGATTTGGGACGGCCAGTCTAAAGGATGACGTGGAGGATATAGCGGCGCTTGTCAACTATCTC
CGCGGTCTGGGCAGGGAGAAGATTGTCTTATTTGGCCATTCGACCGGGTGCCAAGACTGCATGGAATACGTCAAG
CAGAGCAGCCCGCCCGTGGACGGCTTTATCCTACAGGCACCGGTATCGGACAGGGAAGGATTGGATCTGTTTGAG
CCAGACTTTAAGACGACGCTGGATCTGGCCAAGAGTTGGATCGCGCAAGGCAAGGCGAACGACTGCCTTCCTCGC
AATATGGTTCCCAGCTCGCTTGGGGCCCCTGTCTCAGCCTACAGGCTGTACTCGCTTTGGGCCAAGGGGGGAGAC
GACGACTACTTCTCTTCGGATCTAGACGACGAGACGGTCCTTCGGGTCTGGGGCAGATTCACAAAGCCGGTCTTG
GTGCTGCATTCGGAGCGGGACGAGTTTGTGCCGCAGCAGATCGACCAGGCAGGGTTGAACGCCAAGTACCGTGGC
GCGAATTCGATGGTCAGCGGGCTCTCTGGGCTGATTCCCGGCACGGGTCATACCGTGTTGGACGAGGAGGCTCGG
CAATGGGTGGCGAAGCGGGTGGACGAGTTTCTGCGGACGCTGGGATAG
Gene >Ophun1|2595
ATGGCTTCGAGCGACAAGCCATTCCCCGTGCTCGTGCACCCGTACCGCTCTACGTCTAGGGGCACCTGCGCCTAT
GAGCTGGGAAACGGGTCGGCACGCAATGCCATCATCTTCATAGGCGGCCTCTCGGACGGTCCGCACACGACGCCA
TATATCCGGAGGGTAGCGGGACGGCTTCAAGAGGCCAATGACCTCAGCTACTCCGTGTTTGAGATCCGACTGAGG
AGCGCATTTACCGGATTTGGGACGGCCAGTCTAAAGGATGACGTGGAGGATATAGCGGCGCTTGTCAACTATCTC
CGCGGTCTGGGCAGGGAGAAGATTGTCTTATTTGGCCATTCGACCGGGTGCCAAGTATTGAATGCCCTTATCCTG
GGCTCTGGGCGGCGGTTGCTGACGGCCACAGGACTGCATGGAATACGTCAAGCAGAGCAGCCCGCCCGTGGACGG
CTTTATCCTACAGGCACCGGTATCGGACAGGGAAGGATTGGATCTGTTTGAGCCAGACTTTAAGACGACGCTGGA
TCTGGCCAAGAGTTGGATCGCGCAAGGCAAGGCGAACGACTGCCTTCCTCGCAATATGGTTCCCAGCTCGCTTGG
GGCCCCTGTCTCAGCCTACAGGCTGTACTCGCTTTGGGCCAAGGGGTAGGCGCCGACGAATTTGTGATGGGGCAT
TGTTGACAAGCCACGGCAGGGGAGACGACGACTACTTCTCTTCGGATCTAGACGACGAGACGGTCCTTCGGGTCT
GGGGCAGATTCACAAAGCCGGTCTTGGTGCTGCATTCGGAGCGGGACGAGTTTGTGCCGCAGCAGATCGACCAGG
CAGGGTTGAACGCCAAGTACCGTGGCGCGAATTCGATGGTCAGCGGGCTCTCTGGGCTGATTCCCGGCACGGGTC
ATACCGTGTTGGACGAGGAGGCTCGGCAATGGGTGGCGAAGCGGGTGGACGAGTTTCTGCGGACGCTGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail