Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2589
Gene name
LocationContig_231:16694..18487
Strand-
Gene length (bp)1793
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15924 ALG11_N ALG11 mannosyltransferase N-terminus 2.6E-86 91 299
PF00534 Glycos_transf_1 Glycosyl transferases group 1 2.8E-23 335 503
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 1.4E-12 340 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X092|ALG11_NEUCR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-11 PE=3 SV=1 24 529 0.0E+00
sp|O74878|ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg11 PE=3 SV=1 92 515 3.0E-143
sp|Q2TAA5|ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens GN=ALG11 PE=1 SV=2 91 526 4.0E-118
sp|Q5R7Z6|ALG11_PONAB GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii GN=ALG11 PE=2 SV=2 91 526 2.0E-117
sp|Q3TZM9|ALG11_MOUSE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus GN=Alg11 PE=2 SV=1 91 527 7.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X092|ALG11_NEUCR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-11 PE=3 SV=1 24 529 0.0E+00
sp|O74878|ALG11_SCHPO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg11 PE=3 SV=1 92 515 3.0E-143
sp|Q2TAA5|ALG11_HUMAN GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens GN=ALG11 PE=1 SV=2 91 526 4.0E-118
sp|Q5R7Z6|ALG11_PONAB GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii GN=ALG11 PE=2 SV=2 91 526 2.0E-117
sp|Q3TZM9|ALG11_MOUSE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus GN=Alg11 PE=2 SV=1 91 527 7.0E-117
sp|Q7ZW24|ALG11_DANRE GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio GN=alg11 PE=2 SV=2 92 531 5.0E-116
sp|Q08B22|ALG11_XENLA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis GN=alg11 PE=2 SV=2 93 520 1.0E-113
sp|Q6P312|ALG11_XENTR GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus tropicalis GN=alg11 PE=2 SV=1 91 520 8.0E-112
sp|Q54DM9|ALG11_DICDI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Dictyostelium discoideum GN=alg11 PE=3 SV=1 92 535 3.0E-109
sp|Q6C9T3|ALG11_YARLI GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG11 PE=3 SV=1 52 534 1.0E-100
sp|Q9XEE9|ALG11_ARATH GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Arabidopsis thaliana GN=ALG11 PE=1 SV=2 92 516 3.0E-99
sp|Q6FWD1|ALG11_CANGA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG11 PE=3 SV=1 93 535 2.0E-95
sp|P53993|YMP8_CAEEL Uncharacterized glycosyltransferase B0361.8 OS=Caenorhabditis elegans GN=B0361.8 PE=3 SV=3 92 527 7.0E-94
sp|Q75B12|ALG11_ASHGO GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG11 PE=3 SV=1 91 529 1.0E-93
sp|Q6CLD6|ALG11_KLULA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG11 PE=3 SV=1 91 519 2.0E-93
sp|P53954|ALG11_YEAST GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG11 PE=1 SV=1 77 470 2.0E-90
sp|Q6BVB2|ALG11_DEBHA GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG11 PE=3 SV=2 91 474 4.0E-79
sp|Q59S72|ALG11_CANAL GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG11 PE=3 SV=1 91 465 3.0E-63
sp|A0LQY9|MSHA_ACIC1 D-inositol 3-phosphate glycosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=mshA PE=3 SV=1 277 459 5.0E-07
sp|Q4JSW2|MSHA_CORJK D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=mshA PE=3 SV=1 282 516 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2589
MDGPRTASPGGGLSPFGLVLASIPLITIFAVPFLLRELAFALGWMLRQRTSGRRSQLLALMTDDDIAFRKQHGGP
DVTTTGEADGSDWDGIVGFFHPFCNAGGGGERVLWAAIRATQSRWPSAKCVVYTGDHDMTKEAIIQRVKSRFNIQ
LYPPTIIFLYLSKRHWVLSSTWPRFTLLGQSLGSMILAWDAFSLLVPDIFIDTMGYAFALGLCNMLFRPTPTGAY
VHYPTISTDMLDSLDPKSSVGSQGVNAGQGSGLRGRAKKAYWRLFARLYSAVGSSIDVVMTNSTWTQAHIQSLWG
PYRRKRDAESPIAVVYPPVAVRDVEEVVELSDESEKKREKVILYIAQFRPEKNHELVLQSFAEFLKSGGPAADDA
QLVLIGSVRDDQDSKKVYQLRLLANELGVKHRVTFHLDAPWPDMVNWLGRASVGVNAMWNEHFGIGVVEYQAAGL
ISVVHDSGGPKLDIVVDMDGKPTGFHATSAAEFAACFAKALSLSDPLAMRLRARASAARFTDEAFATLWLTHMSR
LVGLSRRRGSVKGR*
Coding >Ophun1|2589
ATGGACGGCCCCCGCACCGCCTCCCCGGGCGGCGGGCTGTCCCCATTCGGCCTCGTCCTCGCCTCGATCCCCCTC
ATCACCATCTTCGCCGTTCCCTTTCTCCTTCGCGAGCTCGCCTTTGCTCTGGGTTGGATGTTGCGTCAGCGGACC
AGCGGCAGACGATCCCAGCTGCTGGCCTTGATGACCGATGACGACATCGCCTTCCGGAAGCAACACGGCGGCCCG
GACGTCACGACCACGGGTGAGGCGGACGGCAGCGACTGGGACGGCATCGTCGGCTTCTTTCATCCCTTCTGCAAC
GCTGGTGGCGGCGGGGAGCGAGTTCTCTGGGCTGCTATCCGCGCGACGCAGAGTCGATGGCCCAGCGCAAAATGT
GTCGTCTACACGGGAGACCATGACATGACAAAGGAGGCCATCATACAGAGAGTCAAGAGCCGGTTCAATATCCAA
CTCTACCCACCAACCATCATCTTTCTCTATCTATCCAAGCGTCATTGGGTACTCTCCAGTACCTGGCCGCGCTTC
ACCCTCCTCGGCCAGTCGCTTGGTTCCATGATTCTGGCATGGGATGCCTTTTCCCTCCTGGTTCCGGATATATTC
ATCGACACCATGGGCTACGCCTTTGCCCTCGGCCTTTGCAACATGCTATTCCGCCCTACACCGACGGGCGCATAT
GTTCACTACCCGACAATCTCTACCGACATGCTCGACTCTCTCGACCCCAAGTCGAGCGTAGGCTCCCAAGGCGTC
AACGCCGGTCAGGGCAGTGGTCTCCGTGGACGAGCCAAAAAGGCATACTGGCGCCTCTTTGCACGCCTGTACTCT
GCCGTCGGCTCTTCCATCGACGTCGTCATGACCAACTCTACCTGGACGCAAGCCCATATCCAGAGCCTTTGGGGT
CCCTACCGCCGGAAGAGAGACGCGGAATCTCCCATTGCCGTCGTTTATCCCCCCGTCGCCGTTCGCGACGTTGAA
GAAGTCGTCGAGCTGTCCGACGAGAGCGAGAAGAAGCGAGAAAAAGTGATACTCTACATTGCGCAATTCCGTCCG
GAAAAGAACCACGAGCTCGTGCTTCAGTCGTTTGCCGAGTTTCTCAAGAGTGGCGGCCCAGCAGCAGACGACGCC
CAACTAGTCCTCATCGGCAGCGTCCGCGACGACCAAGACTCCAAAAAGGTCTACCAACTTCGTCTCCTAGCCAAC
GAGCTAGGCGTCAAGCACCGCGTCACCTTCCACCTCGACGCCCCCTGGCCCGACATGGTCAACTGGCTGGGCAGG
GCCTCGGTCGGCGTCAACGCCATGTGGAACGAGCACTTTGGCATCGGCGTCGTCGAGTACCAAGCAGCCGGTCTC
ATATCCGTCGTCCACGACAGCGGCGGGCCCAAGCTGGACATTGTCGTCGACATGGACGGCAAGCCAACGGGCTTC
CACGCGACGTCGGCTGCAGAGTTCGCTGCGTGTTTCGCAAAGGCGCTGTCCCTGTCTGATCCGCTCGCCATGAGG
TTGAGGGCGCGCGCCTCGGCTGCCAGGTTCACGGACGAGGCTTTCGCGACGCTTTGGTTGACGCATATGAGTCGG
CTCGTGGGACTGTCTAGACGCAGGGGGTCGGTGAAGGGACGATGA
Transcript >Ophun1|2589
ATGGACGGCCCCCGCACCGCCTCCCCGGGCGGCGGGCTGTCCCCATTCGGCCTCGTCCTCGCCTCGATCCCCCTC
ATCACCATCTTCGCCGTTCCCTTTCTCCTTCGCGAGCTCGCCTTTGCTCTGGGTTGGATGTTGCGTCAGCGGACC
AGCGGCAGACGATCCCAGCTGCTGGCCTTGATGACCGATGACGACATCGCCTTCCGGAAGCAACACGGCGGCCCG
GACGTCACGACCACGGGTGAGGCGGACGGCAGCGACTGGGACGGCATCGTCGGCTTCTTTCATCCCTTCTGCAAC
GCTGGTGGCGGCGGGGAGCGAGTTCTCTGGGCTGCTATCCGCGCGACGCAGAGTCGATGGCCCAGCGCAAAATGT
GTCGTCTACACGGGAGACCATGACATGACAAAGGAGGCCATCATACAGAGAGTCAAGAGCCGGTTCAATATCCAA
CTCTACCCACCAACCATCATCTTTCTCTATCTATCCAAGCGTCATTGGGTACTCTCCAGTACCTGGCCGCGCTTC
ACCCTCCTCGGCCAGTCGCTTGGTTCCATGATTCTGGCATGGGATGCCTTTTCCCTCCTGGTTCCGGATATATTC
ATCGACACCATGGGCTACGCCTTTGCCCTCGGCCTTTGCAACATGCTATTCCGCCCTACACCGACGGGCGCATAT
GTTCACTACCCGACAATCTCTACCGACATGCTCGACTCTCTCGACCCCAAGTCGAGCGTAGGCTCCCAAGGCGTC
AACGCCGGTCAGGGCAGTGGTCTCCGTGGACGAGCCAAAAAGGCATACTGGCGCCTCTTTGCACGCCTGTACTCT
GCCGTCGGCTCTTCCATCGACGTCGTCATGACCAACTCTACCTGGACGCAAGCCCATATCCAGAGCCTTTGGGGT
CCCTACCGCCGGAAGAGAGACGCGGAATCTCCCATTGCCGTCGTTTATCCCCCCGTCGCCGTTCGCGACGTTGAA
GAAGTCGTCGAGCTGTCCGACGAGAGCGAGAAGAAGCGAGAAAAAGTGATACTCTACATTGCGCAATTCCGTCCG
GAAAAGAACCACGAGCTCGTGCTTCAGTCGTTTGCCGAGTTTCTCAAGAGTGGCGGCCCAGCAGCAGACGACGCC
CAACTAGTCCTCATCGGCAGCGTCCGCGACGACCAAGACTCCAAAAAGGTCTACCAACTTCGTCTCCTAGCCAAC
GAGCTAGGCGTCAAGCACCGCGTCACCTTCCACCTCGACGCCCCCTGGCCCGACATGGTCAACTGGCTGGGCAGG
GCCTCGGTCGGCGTCAACGCCATGTGGAACGAGCACTTTGGCATCGGCGTCGTCGAGTACCAAGCAGCCGGTCTC
ATATCCGTCGTCCACGACAGCGGCGGGCCCAAGCTGGACATTGTCGTCGACATGGACGGCAAGCCAACGGGCTTC
CACGCGACGTCGGCTGCAGAGTTCGCTGCGTGTTTCGCAAAGGCGCTGTCCCTGTCTGATCCGCTCGCCATGAGG
TTGAGGGCGCGCGCCTCGGCTGCCAGGTTCACGGACGAGGCTTTCGCGACGCTTTGGTTGACGCATATGAGTCGG
CTCGTGGGACTGTCTAGACGCAGGGGGTCGGTGAAGGGACGATGA
Gene >Ophun1|2589
ATGGACGGCCCCCGCACCGCCTCCCCGGGCGGCGGGCTGTCCCCATTCGGCCTCGTCCTCGCCTCGATCCCCCTC
ATCACCATCTTCGCCGTTCCCTTTCTCCTTCGCGAGCTCGCCTTTGCTCTGGGTTGGATGTTGCGTCAGCGGACC
AGCGGCAGACGATCCCAGCTGCTGGCCTTGATGACCGATGACGACATCGCCTTCCGGAAGCAACACGGCGGCCCG
GACGTCACGACCACGGGTGAGGCGGACGGCAGCGACTGGGACGGCATCGTCGGCTTCTTTCATCCCTTCTGGTGA
GTTTGGATCCTGCGTCTGTACTTGGGTGTTGACTTGGTTTAGCAACGCTGGTGGCGGCGGGGAGCGAGTTCTCTG
GGCTGCTATCCGCGCGACGCAGAGTCGATGGCCCAGCGCAAAATGTGTCGTCTACACGGGAGACCATGACATGAC
AAAGGAGGCCATCATACAGAGAGTCAAGGTGGGCTCGGTCATCCATCCCCTCTGCAACCTCGACCTAACGAGGCT
CAGAGCCGGTTCAATATCCAACTCTACCCACCAACCATCATCTTTCTCTATCTATCCAAGCGTCATTGGGTACTC
TCCAGTACCTGGCCGCGCTTCACCCTCCTCGGCCAGTCGCTTGGTTCCATGATTCTGGCATGGGATGCCTTTTCC
CTCCTGGTTCCGGATATATTCATCGACACCATGGGCTACGCCTTTGCCCTCGGCCTTTGCAACATGCTATTCCGC
CCTACACCGACGGGCGCATATGTTCACTACCCGACAATCTCTACCGACATGCTCGACTCTCTCGACCCCAAGTCG
AGCGTAGGCTCCCAAGGCGTCAACGCCGGTCAGGGCAGTGGTCTCCGTGGACGAGCCAAAAAGGCATACTGGCGC
CTCTTTGCACGCCTGTACTCTGCCGTCGGCTCTTCCATCGACGTCGTCATGACCAACTCTACCTGGACGCAAGCC
CATATCCAGAGCCTTTGGGGTCCCTACCGCCGGAAGAGAGACGCGGAATCTCCCATTGCCGTCGTTTATCCCCCC
GTCGCCGTTCGCGACGTTGAAGAAGTCGTCGAGCTGTCCGACGAGAGCGAGAAGAAGCGAGAAAAAGTGATACTC
TACATTGCGCAATTCCGTCCGGAAAAGAACCACGAGCTCGTGCTTCAGTCGTTTGCCGAGTTTCTCAAGAGTGGC
GGCCCAGCAGCAGACGACGCCCAACTAGTCCTCATCGGCAGCGTCCGCGACGACCAAGACTCCAAAAAGGTCTAC
CAACTTCGTCTCCTAGCCAACGAGCTAGGCGTCAAGCACCGCGTCACCTTCCACCTCGACGCCCCCTGGCCCGAC
ATGGTCAACTGGCTGGGCAGGGCCTCGGTCGGCGTCAACGCCATGTGGAACGAGCACTTTGGCATCGGCGTCGTC
GAGTACCAAGCAGCCGGTCTCATATCCGTCGTCCACGACAGCGGCGGGCCCAAGCTGGACATTGTCGTCGACATG
GACGGCAAGCCAACGGGTAAGTCGACTTTTCCCTCTTTTTCAGGACAGGTCTGGCTGATGATGACCATGTGTCTT
CGTCCCCTCTTCTCCTAGGCTTCCACGCGACGTCGGCTGCAGAGTTCGCTGCGTGTTTCGCAAAGGCGCTGTCCC
TGTCTGATCCGCTCGCCATGAGGTTGAGGGCGCGCGCCTCGGCTGCCAGGTTCACGGACGAGGCTTTCGCGACGC
TTTGGTTGACGCATATGAGTCGGCTCGTGGGACTGTCTAGACGCAGGGGGTCGGTGAAGGGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail