Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2588
Gene name
LocationContig_231:14193..16355
Strand+
Gene length (bp)2162
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 9.4E-163 57 562

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 39 569 2.0E-180
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 41 561 3.0E-114
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 41 561 2.0E-113
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 39 561 8.0E-113
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 40 561 1.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 39 569 2.0E-180
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 41 561 3.0E-114
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 41 561 2.0E-113
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 39 561 8.0E-113
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 40 561 1.0E-111
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 36 562 7.0E-110
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 40 561 7.0E-108
sp|A6NGU5|GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2 41 561 2.0E-106
sp|P36268|GGT2_HUMAN Inactive gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3 41 561 5.0E-103
sp|Q9M0G0|GAGT3_ARATH Gamma-glutamyltranspeptidase 3 OS=Arabidopsis thaliana GN=GGT3 PE=2 SV=1 42 545 6.0E-97
sp|Q8VYW6|GAGT1_ARATH Gamma-glutamyltranspeptidase 1 OS=Arabidopsis thaliana GN=GGT1 PE=2 SV=1 40 561 1.0E-92
sp|Q680I5|GAGT2_ARATH Gamma-glutamyltranspeptidase 2 OS=Arabidopsis thaliana GN=GGT2 PE=2 SV=1 41 561 3.0E-92
sp|P18956|GGT_ECOLI Gamma-glutamyltranspeptidase OS=Escherichia coli (strain K12) GN=ggt PE=1 SV=1 41 560 1.0E-90
sp|P36267|GGT_PSEUA Gamma-glutamyltranspeptidase OS=Pseudomonas sp. (strain A14) GN=ggt PE=1 SV=1 41 533 1.0E-76
sp|Q9I406|GGT_PSEAE Gamma-glutamyltranspeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ggt PE=3 SV=1 42 562 9.0E-71
sp|P54422|GGT_BACSU Gamma-glutamyltranspeptidase OS=Bacillus subtilis (strain 168) GN=ggt PE=1 SV=1 6 558 7.0E-66
sp|Q05902|ECM38_YEAST Gamma-glutamyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM38 PE=1 SV=1 36 558 2.0E-65
sp|P63186|GGT_BACNA Gamma-glutamyltranspeptidase OS=Bacillus subtilis subsp. natto GN=ggt PE=1 SV=1 6 507 3.0E-64
sp|Q9QWE9|GGT5_RAT Gamma-glutamyltransferase 5 OS=Rattus norvegicus GN=Ggt5 PE=2 SV=1 41 556 3.0E-64
sp|Q9Z2A9|GGT5_MOUSE Gamma-glutamyltransferase 5 OS=Mus musculus GN=Ggt5 PE=1 SV=2 31 556 3.0E-60
sp|Q05053|PAC1_PSESV Acylase ACY 1 OS=Pseudomonas sp. (strain V22) GN=acyI PE=1 SV=2 39 560 1.0E-58
sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2 8 569 1.0E-57
sp|Q0V8L2|GGT7_BOVIN Gamma-glutamyltransferase 7 OS=Bos taurus GN=GGT7 PE=2 SV=1 8 569 2.0E-57
sp|P15557|PAC1_PSES3 Acylase ACY 1 OS=Pseudomonas sp. (strain SE83) GN=acyI PE=1 SV=2 18 560 3.0E-57
sp|Q99MZ4|GGT7_RAT Gamma-glutamyltransferase 7 OS=Rattus norvegicus GN=Ggt7 PE=1 SV=2 8 566 5.0E-57
sp|Q99JP7|GGT7_MOUSE Gamma-glutamyltransferase 7 OS=Mus musculus GN=Ggt7 PE=1 SV=2 8 569 1.0E-55
sp|P36269|GGT5_HUMAN Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2 51 548 2.0E-50
sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2 341 561 1.0E-48
sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1 341 561 4.0E-44
sp|O05218|YWRD_BACSU Putative gamma-glutamyltransferase YwrD OS=Bacillus subtilis (strain 168) GN=ywrD PE=1 SV=1 39 560 7.0E-40
sp|P74181|GGT_SYNY3 Gamma-glutamyltranspeptidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggt PE=3 SV=1 42 561 2.0E-37
sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4 341 561 3.0E-37
sp|Q51693|CAPD_BACAN Capsule biosynthesis protein CapD OS=Bacillus anthracis GN=capD PE=1 SV=2 55 534 2.0E-36
sp|Q9CAR5|GAGT4_ARATH Putative inactive gamma-glutamyltranspeptidase 4 OS=Arabidopsis thaliana GN=GGT4 PE=5 SV=1 324 514 4.0E-32
sp|A7YWM1|GGT6_BOVIN Gamma-glutamyltransferase 6 OS=Bos taurus GN=GGT6 PE=2 SV=1 7 221 3.0E-15
sp|Q6IE08|GGT6_RAT Gamma-glutamyltransferase 6 OS=Rattus norvegicus GN=Ggt6 PE=2 SV=1 32 292 9.0E-12
sp|Q6P531|GGT6_HUMAN Gamma-glutamyltransferase 6 OS=Homo sapiens GN=GGT6 PE=2 SV=2 41 284 1.0E-09
sp|Q6PDE7|GGT6_MOUSE Gamma-glutamyltransferase 6 OS=Mus musculus GN=Ggt6 PE=2 SV=1 37 176 3.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.965624

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3230
Ophiocordyceps australis 1348a (Ghana) OphauG2|6609
Ophiocordyceps australis map64 (Brazil) OphauB2|1642
Ophiocordyceps australis map64 (Brazil) OphauB2|3863
Ophiocordyceps camponoti-floridani Ophcf2|02409
Ophiocordyceps camponoti-floridani Ophcf2|06740
Ophiocordyceps camponoti-rufipedis Ophun1|2588 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|858
Ophiocordyceps kimflemingae Ophio5|6050
Ophiocordyceps kimflemingae Ophio5|914
Ophiocordyceps subramaniannii Hirsu2|7282
Ophiocordyceps subramaniannii Hirsu2|9336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2588
MPDLNVLSMRRLAGLIAVAASLCHGSPVSVVLGPTVKPGARGAVASEASECSHIGRDLLSQGGNAADAVVGTTFC
VGIVAPYHSGIGGGGFALVRDADGRYEAVDFRETAPAAAYQDMYRGNVAGSLTGGLAVAVPGEVRGLEHIHRKYG
SLPWETVLKGAIDVARDGFRISSDLAARMTSAKQPFLLKDPSFALDFAPNGTLLREGDIMTRKRYADTLERIARE
GSAAFYRGELAEAMARLVQASNGTMTVDDLDRYTVVSRPVQRLRYRGLDLFSVGAPASGAVGLGILKVAEQFAPV
EADAGVEAHRFVEAMRFGYGARARLADPDFVPGVDALEGRLLNEEYARQVGKRIDDRHTLPVADYDPTVNEYVPN
SHGTSHVVTADASGMAVSLTTTINLIFGAQLMEPLSGIVLNNEMNDFSIPGIPNDFGFPPSVANYIAPGKRPLSS
ITPVIAAHPNGSILAVVGAAGGSRIISATASALWHLVDHGDSMADALRRPRMHDQLMPNVLLLEYAFDNRTAAAL
AAKGHDISRVGEGLSAVQAIRRRADGSFEAAAEPRQRNSRGFVV*
Coding >Ophun1|2588
ATGCCGGACTTAAATGTCTTGTCCATGCGTCGACTGGCAGGCCTCATCGCCGTCGCCGCCTCCCTCTGCCATGGC
TCTCCCGTCTCTGTCGTCCTCGGCCCGACGGTGAAACCAGGCGCGAGAGGCGCCGTGGCCAGCGAGGCTTCAGAA
TGTAGCCACATCGGCAGGGACCTGCTCTCTCAAGGCGGGAACGCGGCAGACGCCGTCGTCGGCACTACCTTTTGT
GTCGGCATCGTCGCCCCGTATCATTCGGGCATCGGCGGCGGAGGCTTCGCTCTGGTCCGCGACGCAGATGGTCGC
TATGAGGCTGTCGACTTCAGGGAGACGGCTCCGGCGGCTGCCTACCAGGACATGTACCGCGGAAACGTCGCTGGC
AGTCTAACAGGTGGACTCGCCGTCGCGGTCCCCGGTGAGGTCCGCGGTCTGGAGCACATCCATCGCAAATACGGC
TCGCTGCCATGGGAGACGGTGCTGAAAGGTGCCATCGATGTCGCTCGTGACGGCTTCCGTATCTCGAGCGACCTG
GCAGCCAGGATGACGAGCGCAAAGCAGCCCTTTCTGCTCAAGGATCCCAGCTTCGCTCTCGACTTTGCGCCAAAC
GGCACCCTCCTCCGTGAGGGAGACATCATGACGCGGAAGCGCTACGCCGACACGCTCGAGCGCATTGCCCGAGAA
GGCTCAGCGGCCTTCTACCGCGGCGAGCTCGCCGAGGCCATGGCCAGGCTCGTCCAGGCCTCCAACGGAACCATG
ACGGTCGACGACCTCGACCGCTACACCGTCGTTTCGCGCCCCGTCCAGCGCCTCCGCTACCGAGGACTGGACCTC
TTCTCCGTCGGCGCTCCGGCCAGCGGCGCCGTCGGGCTGGGCATCCTCAAGGTCGCGGAGCAGTTTGCGCCCGTC
GAGGCAGATGCTGGTGTCGAGGCTCATCGGTTCGTCGAGGCGATGCGCTTCGGCTACGGAGCACGCGCCAGGCTC
GCTGACCCGGACTTTGTGCCTGGCGTTGACGCGCTCGAGGGTCGTTTGCTGAATGAGGAATATGCGCGTCAGGTT
GGGAAGCGCATCGATGATCGTCATACATTACCTGTTGCAGACTACGACCCAACTGTCAATGAGTATGTGCCTAAC
AGCCACGGAACGTCTCATGTCGTCACCGCCGATGCGTCCGGCATGGCCGTCTCTCTCACCACCACCATCAACCTC
ATCTTCGGCGCCCAACTCATGGAACCCCTGAGCGGCATCGTGCTGAACAACGAGATGAACGACTTCTCCATCCCC
GGCATCCCCAACGACTTCGGCTTCCCTCCCTCAGTGGCAAACTACATCGCCCCCGGAAAACGCCCCCTATCATCC
ATAACGCCCGTCATTGCCGCCCACCCCAACGGCTCTATTCTCGCCGTCGTCGGCGCAGCAGGCGGCTCGCGCATC
ATCTCCGCCACTGCCTCTGCCCTCTGGCACCTAGTCGACCACGGCGACTCCATGGCCGACGCCCTGCGTCGCCCG
CGCATGCACGATCAACTCATGCCCAATGTGCTACTGCTAGAATACGCCTTTGATAACCGGACGGCTGCCGCGCTG
GCGGCTAAGGGCCACGACATCTCCCGTGTTGGCGAGGGGCTCAGCGCTGTGCAAGCCATTCGCAGACGGGCTGAT
GGCTCTTTTGAGGCGGCGGCTGAGCCGAGGCAGAGGAATAGTCGGGGCTTTGTTGTGTAG
Transcript >Ophun1|2588
ATGCCGGACTTAAATGTCTTGTCCATGCGTCGACTGGCAGGCCTCATCGCCGTCGCCGCCTCCCTCTGCCATGGC
TCTCCCGTCTCTGTCGTCCTCGGCCCGACGGTGAAACCAGGCGCGAGAGGCGCCGTGGCCAGCGAGGCTTCAGAA
TGTAGCCACATCGGCAGGGACCTGCTCTCTCAAGGCGGGAACGCGGCAGACGCCGTCGTCGGCACTACCTTTTGT
GTCGGCATCGTCGCCCCGTATCATTCGGGCATCGGCGGCGGAGGCTTCGCTCTGGTCCGCGACGCAGATGGTCGC
TATGAGGCTGTCGACTTCAGGGAGACGGCTCCGGCGGCTGCCTACCAGGACATGTACCGCGGAAACGTCGCTGGC
AGTCTAACAGGTGGACTCGCCGTCGCGGTCCCCGGTGAGGTCCGCGGTCTGGAGCACATCCATCGCAAATACGGC
TCGCTGCCATGGGAGACGGTGCTGAAAGGTGCCATCGATGTCGCTCGTGACGGCTTCCGTATCTCGAGCGACCTG
GCAGCCAGGATGACGAGCGCAAAGCAGCCCTTTCTGCTCAAGGATCCCAGCTTCGCTCTCGACTTTGCGCCAAAC
GGCACCCTCCTCCGTGAGGGAGACATCATGACGCGGAAGCGCTACGCCGACACGCTCGAGCGCATTGCCCGAGAA
GGCTCAGCGGCCTTCTACCGCGGCGAGCTCGCCGAGGCCATGGCCAGGCTCGTCCAGGCCTCCAACGGAACCATG
ACGGTCGACGACCTCGACCGCTACACCGTCGTTTCGCGCCCCGTCCAGCGCCTCCGCTACCGAGGACTGGACCTC
TTCTCCGTCGGCGCTCCGGCCAGCGGCGCCGTCGGGCTGGGCATCCTCAAGGTCGCGGAGCAGTTTGCGCCCGTC
GAGGCAGATGCTGGTGTCGAGGCTCATCGGTTCGTCGAGGCGATGCGCTTCGGCTACGGAGCACGCGCCAGGCTC
GCTGACCCGGACTTTGTGCCTGGCGTTGACGCGCTCGAGGGTCGTTTGCTGAATGAGGAATATGCGCGTCAGGTT
GGGAAGCGCATCGATGATCGTCATACATTACCTGTTGCAGACTACGACCCAACTGTCAATGAGTATGTGCCTAAC
AGCCACGGAACGTCTCATGTCGTCACCGCCGATGCGTCCGGCATGGCCGTCTCTCTCACCACCACCATCAACCTC
ATCTTCGGCGCCCAACTCATGGAACCCCTGAGCGGCATCGTGCTGAACAACGAGATGAACGACTTCTCCATCCCC
GGCATCCCCAACGACTTCGGCTTCCCTCCCTCAGTGGCAAACTACATCGCCCCCGGAAAACGCCCCCTATCATCC
ATAACGCCCGTCATTGCCGCCCACCCCAACGGCTCTATTCTCGCCGTCGTCGGCGCAGCAGGCGGCTCGCGCATC
ATCTCCGCCACTGCCTCTGCCCTCTGGCACCTAGTCGACCACGGCGACTCCATGGCCGACGCCCTGCGTCGCCCG
CGCATGCACGATCAACTCATGCCCAATGTGCTACTGCTAGAATACGCCTTTGATAACCGGACGGCTGCCGCGCTG
GCGGCTAAGGGCCACGACATCTCCCGTGTTGGCGAGGGGCTCAGCGCTGTGCAAGCCATTCGCAGACGGGCTGAT
GGCTCTTTTGAGGCGGCGGCTGAGCCGAGGCAGAGGAATAGTCGGGGCTTTGTTGTGTAG
Gene >Ophun1|2588
ATGCCGGACTTAAATGGTAAGCTCCGAGGTCGGAGCGGCCGACCCACGACGTGGATGTTGGTGGTTGCTGCTGCC
CAATCTGCCCTCAGGGAGGGTTACGGGGAGTCATGAGATGGAGCGCGTGGGCGTGGGCGTGACCTCTGTCTCGGA
TGCCGCCATTTCTCCGTGCTGGGGTTCTTTAAGAATATCTATCTAGGTCTCGAACTCGCTCTTTTCGTCAGCTTC
TTGCCCAGTGGTTTCAGAGAGAGGACAACGACAGAGAGACTGACGAAAGAGACAGATGATGGGTACCTACACACG
ACTCTTTGTGACGCCATTATGAACACATCCCTAAGTGCTGACTGCTAATTCACACCTAGTCTTGTCCATGCGTCG
ACTGGCAGGCCTCATCGCCGTCGCCGCCTCCCTCTGCCATGGCTCTCCCGTCTCTGTCGTCCTCGGCCCGACGGT
GAAACCAGGCGCGAGAGGCGCCGTGGCCAGCGAGGCTTCAGAATGTAGCCACATCGGCAGGGACCTGCTCTCTCA
AGGCGTACGTTTCCTCCCTTGCGTCGCTTGCGTCCCTTTATTGAAAGCTTCTGTATAGGGGAACGCGGCAGACGC
CGTCGTCGGCACTACCTTTTGTGTCGGCATCGTCGCCCCGTATCATTCGGGCATCGGCGGCGGAGGCTTCGCTCT
GGTCCGCGACGCAGATGGTCGCTATGAGGCTGTCGACTTCAGGGAGACGGCTCCGGCGGCTGCCTACCAGGACAT
GTACCGCGGAAACGTCGCTGGCAGTCTAACAGGTGGACTCGCCGTCGCGGTCCCCGGTGAGGTCCGCGGTCTGGA
GCACATCCATCGCAAATACGGCTCGCTGCCATGGGAGACGGTGCTGAAAGGTGCCATCGATGTCGCTCGTGACGG
CTTCCGTATCTCGAGCGACCTGGCAGCCAGGATGACGAGCGCAAAGCAGCCCTTTCTGCTCAAGGATCCCAGCTT
CGCTCTCGACTTTGCGCCAAACGGCACCCTCCTCCGTGAGGGAGACATCATGACGCGGAAGCGCTACGCCGACAC
GCTCGAGCGCATTGCCCGAGAAGGCTCAGCGGCCTTCTACCGCGGCGAGCTCGCCGAGGCCATGGCCAGGCTCGT
CCAGGCCTCCAACGGAACCATGACGGTCGACGACCTCGACCGCTACACCGTCGTTTCGCGCCCCGTCCAGCGCCT
CCGCTACCGAGGACTGGACCTCTTCTCCGTCGGCGCTCCGGCCAGCGGCGCCGTCGGGCTGGGCATCCTCAAGGT
CGCGGAGCAGTTTGCGCCCGTCGAGGCAGATGCTGGTGTCGAGGCTCATCGGTTCGTCGAGGCGATGCGCTTCGG
CTACGGAGCACGCGCCAGGCTCGCTGACCCGGACTTTGTGCCTGGCGTTGACGCGCTCGAGGGTCGTTTGCTGAA
TGAGGAATATGCGCGTCAGGTTGGGAAGCGCATCGATGATCGTCATACATTACCTGTTGCAGACTACGACCCAAC
TGTCAATGAGTATGTGCCTAACAGCCACGGAACGTCTCATGTCGTCACCGCCGATGCGTCCGGCATGGCCGTCTC
TCTCACCACCACCATCAACCTCATCTTCGGCGCCCAACTCATGGAACCCCTGAGCGGCATCGTGCTGTATATACA
TTTACCCCCTATCCCCCAAGGAATCAATTCTGACGTCAAAGCCCAGGAACAACGAGATGAACGACTTCTCCATCC
CCGGCATCCCCAACGACTTCGGCTTCCCTCCCTCAGTGGCAAACTACATCGCCCCCGGAAAACGCCCCCTATCAT
CCATAACGCCCGTCATTGCCGCCCACCCCAACGGCTCTATTCTCGCCGTCGTCGGCGCAGCAGGCGGCTCGCGCA
TCATCTCCGCCACTGCCTCTGCCCTCTGGCACCTAGTCGACCACGGCGACTCCATGGCCGACGCCCTGCGTCGCC
CGCGCATGCACGATCAACTCATGCCCAATGTGCTACTGCTAGAATACGCCTTTGATAACCGGACGGCTGCCGCGC
TGGCGGCTAAGGGCCACGACATCTCCCGTGTTGGCGAGGGGCTCAGCGCTGTGCAAGCCATTCGCAGACGGGCTG
ATGGCTCTTTTGAGGCGGCGGCTGAGCCGAGGCAGAGGAATAGTCGGGGCTTTGTTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail