Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2584
Gene name
LocationContig_231:6143..6854
Strand-
Gene length (bp)711
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14273 DUF4360 Domain of unknown function (DUF4360) 7.6E-38 24 197

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATM6|A7590_ARTBC Uncharacterized secreted protein ARB_07590 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07590 PE=1 SV=1 19 197 5.0E-18
sp|D4AV98|A0107_ARTBC Uncharacterized secreted protein ARB_00107 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00107 PE=1 SV=1 10 197 1.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999689

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1781
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02562
Ophiocordyceps camponoti-floridani Ophcf2|06744
Ophiocordyceps camponoti-rufipedis Ophun1|2584 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3583
Ophiocordyceps kimflemingae Ophio5|5525
Ophiocordyceps kimflemingae Ophio5|994
Ophiocordyceps subramaniannii Hirsu2|171

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2584
MMLPILTMLLGLASAAPQPPPGLFNIHDIEIIGTGCSPEHDHVSVDKSRTLFEISFSEYGVQSGPGIRASEWRKN
CKLILNLDYSSGFQFRLVGINMAGYAAIPYGSSGQCVNSFSFAGSGSARTDYIVKMEGPLNGRFDLESTSGFSAW
STCGKSSSILNLNTACSIDATDDKAYIAVDEVSGRLTVKCGIEWRRC*
Coding >Ophun1|2584
ATGATGCTCCCGATTCTCACCATGTTGCTTGGCCTCGCCAGCGCCGCCCCTCAACCACCTCCCGGCCTATTCAAC
ATCCACGACATCGAAATCATCGGAACGGGCTGTTCGCCAGAACATGACCACGTGTCGGTTGACAAGAGCCGAACC
CTCTTCGAAATCAGCTTCTCCGAATACGGAGTACAATCGGGCCCCGGTATCCGCGCCAGCGAGTGGCGAAAGAAC
TGCAAGCTCATCCTCAACCTCGATTACAGCAGCGGTTTCCAGTTCCGCCTCGTGGGGATCAACATGGCGGGCTAC
GCGGCGATACCGTATGGCTCCAGCGGACAATGCGTCAATAGCTTCTCCTTCGCGGGCAGCGGCTCAGCCCGAACC
GACTACATTGTCAAGATGGAGGGCCCGCTCAATGGCAGATTCGATCTCGAGTCCACCTCTGGCTTCTCGGCTTGG
TCGACGTGCGGCAAAAGCTCATCCATCCTGAACCTGAACACGGCCTGCAGCATTGACGCAACTGACGATAAGGCG
TACATCGCCGTCGACGAGGTGAGCGGGAGGCTGACGGTCAAGTGCGGCATAGAGTGGAGGCGCTGCTGA
Transcript >Ophun1|2584
ATGATGCTCCCGATTCTCACCATGTTGCTTGGCCTCGCCAGCGCCGCCCCTCAACCACCTCCCGGCCTATTCAAC
ATCCACGACATCGAAATCATCGGAACGGGCTGTTCGCCAGAACATGACCACGTGTCGGTTGACAAGAGCCGAACC
CTCTTCGAAATCAGCTTCTCCGAATACGGAGTACAATCGGGCCCCGGTATCCGCGCCAGCGAGTGGCGAAAGAAC
TGCAAGCTCATCCTCAACCTCGATTACAGCAGCGGTTTCCAGTTCCGCCTCGTGGGGATCAACATGGCGGGCTAC
GCGGCGATACCGTATGGCTCCAGCGGACAATGCGTCAATAGCTTCTCCTTCGCGGGCAGCGGCTCAGCCCGAACC
GACTACATTGTCAAGATGGAGGGCCCGCTCAATGGCAGATTCGATCTCGAGTCCACCTCTGGCTTCTCGGCTTGG
TCGACGTGCGGCAAAAGCTCATCCATCCTGAACCTGAACACGGCCTGCAGCATTGACGCAACTGACGATAAGGCG
TACATCGCCGTCGACGAGGTGAGCGGGAGGCTGACGGTCAAGTGCGGCATAGAGTGGAGGCGCTGCTGA
Gene >Ophun1|2584
ATGATGCTCCCGATTCTCACCATGTTGCTTGGCCTCGCCAGCGCCGCCCCTCAACCACCTCCCGGCCTATTCAAC
ATCCACGACATCGAAATCATCGGAACGGGCTGTTCGCCAGAACATGACCACGTGTCGGTTGACAAGAGCCGAACC
CTCTTCGAAATCAGCTTCTCCGAATACGGAGTACAATCGGGCCCCGGTATCCGCGCCAGCGAGTGGCGAAAGAAC
TGCAAGCTCATCCTCAACCTCGATTACAGCAGCGGTTTCCAGTCAGTCGCTTCCCTCGCGTCCCAGGACAGCAAG
ACGATGCTGATGGGCGGCTTAGGTTCCGCCTCGTGGGGATCAACATGGCGGGCTACGCGGCGATACCGTATGGCT
CCAGCGGACAATGCGTCAATAGCTTCTCCTTCGCGGGCAGCGGCTCAGCCCGAACCGACTACATTGTCAAGATGG
AGGGCCCGCTCAATGGCAGATTCGATCTCGAGTCCACCTCTGGCTTCTCGGCTTGGTCGACGTGCGGCAAAAGCT
CATCCATCCTGAACCTGAACACGGCCTGCAGCATTGACGCAACTGACGATAAGGCGTACATCGCCGTAAGCCTCC
TCTCCTCGATACGCTCGGAAGCGACCCTGTGCTAATGGAGAGCTTGATTAGGTCGACGAGGTGAGCGGGAGGCTG
ACGGTCAAGTGCGGCATAGAGTGGAGGCGCTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail