Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2582
Gene name
LocationContig_231:2586..4405
Strand+
Gene length (bp)1819
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01112 Asparaginase_2 Asparaginase 4.2E-27 27 185
PF01112 Asparaginase_2 Asparaginase 8.4E-14 343 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H6P5|TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens GN=TASP1 PE=1 SV=1 29 190 2.0E-26
sp|O65268|TASP1_ARATH Putative threonine aspartase OS=Arabidopsis thaliana GN=At4g00590 PE=2 SV=3 29 186 2.0E-23
sp|Q8R1G1|TASP1_MOUSE Threonine aspartase 1 OS=Mus musculus GN=Tasp1 PE=2 SV=1 29 190 8.0E-22
sp|Q6GM78|ASGL1_XENLA Isoaspartyl peptidase/L-asparaginase OS=Xenopus laevis GN=asrgl1 PE=2 SV=1 27 221 7.0E-20
sp|Q9P6N7|TASP1_SCHPO Putative threonine aspartase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.09c PE=3 SV=3 29 188 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H6P5|TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens GN=TASP1 PE=1 SV=1 29 190 2.0E-26
sp|O65268|TASP1_ARATH Putative threonine aspartase OS=Arabidopsis thaliana GN=At4g00590 PE=2 SV=3 29 186 2.0E-23
sp|Q8R1G1|TASP1_MOUSE Threonine aspartase 1 OS=Mus musculus GN=Tasp1 PE=2 SV=1 29 190 8.0E-22
sp|Q6GM78|ASGL1_XENLA Isoaspartyl peptidase/L-asparaginase OS=Xenopus laevis GN=asrgl1 PE=2 SV=1 27 221 7.0E-20
sp|Q9P6N7|TASP1_SCHPO Putative threonine aspartase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.09c PE=3 SV=3 29 188 1.0E-17
sp|Q32LE5|ASGL1_BOVIN Isoaspartyl peptidase/L-asparaginase OS=Bos taurus GN=ASRGL1 PE=2 SV=1 27 181 9.0E-16
sp|Q8C0M9|ASGL1_MOUSE Isoaspartyl peptidase/L-asparaginase OS=Mus musculus GN=Asrgl1 PE=1 SV=1 29 181 3.0E-15
sp|Q54WW4|ASGX_DICDI Putative isoaspartyl peptidase/L-asparaginase OS=Dictyostelium discoideum GN=DDB_G0279357 PE=3 SV=1 28 185 4.0E-15
sp|Q4R7U8|ASGL1_MACFA Isoaspartyl peptidase/L-asparaginase OS=Macaca fascicularis GN=ASRGL1 PE=2 SV=1 27 181 2.0E-14
sp|Q9V262|ASGX_PYRAB Putative L-asparaginase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB02120 PE=3 SV=1 28 184 2.0E-14
sp|Q8GXG1|ASPGB_ARATH Probable isoaspartyl peptidase/L-asparaginase 2 OS=Arabidopsis thaliana GN=At3g16150 PE=2 SV=2 28 175 3.0E-14
sp|P37595|IAAA_ECOLI Isoaspartyl peptidase OS=Escherichia coli (strain K12) GN=iaaA PE=1 SV=2 29 176 4.0E-14
sp|Q7L266|ASGL1_HUMAN Isoaspartyl peptidase/L-asparaginase OS=Homo sapiens GN=ASRGL1 PE=1 SV=2 27 181 4.0E-14
sp|Q9H6P5|TASP1_HUMAN Threonine aspartase 1 OS=Homo sapiens GN=TASP1 PE=1 SV=1 327 556 7.0E-14
sp|Q8R1G1|TASP1_MOUSE Threonine aspartase 1 OS=Mus musculus GN=Tasp1 PE=2 SV=1 325 556 9.0E-14
sp|Q8VI04|ASGL1_RAT Isoaspartyl peptidase/L-asparaginase OS=Rattus norvegicus GN=Asrgl1 PE=1 SV=1 53 181 1.0E-13
sp|Q8U4E6|ASGX_PYRFU Putative L-asparaginase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0142 PE=3 SV=1 28 184 2.0E-13
sp|O57971|ASGX_PYRHO Putative L-asparaginase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0232 PE=3 SV=1 28 190 2.0E-13
sp|P30362|ASPG_LUPAR Isoaspartyl peptidase/L-asparaginase (Fragment) OS=Lupinus arboreus PE=2 SV=1 47 179 4.0E-13
sp|Q5JHT1|ASGX_THEKO Putative L-asparaginase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK2246 PE=3 SV=1 26 184 4.0E-13
sp|Q9ZSD6|ASPG_LUPLU Isoaspartyl peptidase/L-asparaginase OS=Lupinus luteus PE=1 SV=1 28 179 5.0E-13
sp|Q7CQV5|IAAA_SALTY Isoaspartyl peptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iaaA PE=1 SV=1 29 196 5.0E-13
sp|P30364|ASPG_LUPAN Isoaspartyl peptidase/L-asparaginase OS=Lupinus angustifolius PE=2 SV=1 28 179 8.0E-13
sp|P50287|ASPGA_ARATH Isoaspartyl peptidase/L-asparaginase 1 OS=Arabidopsis thaliana GN=At5g08100 PE=1 SV=2 28 184 2.0E-11
sp|Q5BKW9|ASGL1_DANRE Isoaspartyl peptidase/L-asparaginase OS=Danio rerio GN=asrgl1 PE=2 SV=1 26 186 9.0E-11
sp|P50288|ASPG_LUPAL Isoaspartyl peptidase/L-asparaginase OS=Lupinus albus PE=3 SV=1 28 179 8.0E-10
sp|Q9P6N7|TASP1_SCHPO Putative threonine aspartase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.09c PE=3 SV=3 387 552 1.0E-09
sp|Q47898|ASPG_ELIMR N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase OS=Elizabethkingia miricola PE=1 SV=1 59 182 9.0E-09
sp|O65268|TASP1_ARATH Putative threonine aspartase OS=Arabidopsis thaliana GN=At4g00590 PE=2 SV=3 382 462 9.0E-08
sp|Q29I93|ASGL1_DROPS Probable isoaspartyl peptidase/L-asparaginase GA20639 OS=Drosophila pseudoobscura pseudoobscura GN=GA20639 PE=3 SV=1 27 253 1.0E-07
sp|Q9VXT7|ASGL1_DROME Probable isoaspartyl peptidase/L-asparaginase CG7860 OS=Drosophila melanogaster GN=CG7860 PE=1 SV=1 27 159 2.0E-07
sp|Q8YQB1|ASGX_NOSS1 Isoaspartyl peptidase/L-asparaginase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all3922 PE=1 SV=1 27 139 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4418
Ophiocordyceps australis map64 (Brazil) OphauB2|1177
Ophiocordyceps camponoti-floridani Ophcf2|06746
Ophiocordyceps camponoti-rufipedis Ophun1|2582 (this protein)
Ophiocordyceps kimflemingae Ophio5|5523
Ophiocordyceps subramaniannii Hirsu2|8124

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2582
MMGRNQCGADGVLDRVLRLSQRQTSVPAIFIHAGAGFHSRQNETVHLKACVSAAEMGMRFLKAGATSTEAVEAAL
RILEDKEITNAGYGSNLSMDGTVECDATIVDHLGRSGACGAVPNIRNPISLAKLILDTSNLPLSLRRVPPNALVG
EGARAFAEEHGMTTFANEYLVSTNSRDRFYRWQEDLLRAEGGGKDAAGLGPHLTPSRAATCIPCQYDTAPAVDPL
KSFPREHAAAILTGTWNEGQTDSPYAGTPAVESTNMPESAMFPPTTAMTFAAAARSSLQMPSPQRPMAKDKSRVV
AKPNDLFAQEIRRKVSNAEEERKQYRCPPNHAESGDTSSSGNTRPEAMAPRRLKRPAETTTPDGVSRGPGPKRVP
YWNVDKDDAVTDTIGAIAIDGRGHIAAGSSSGGIGMKHRGRLGPAAIVGVGTAVVPCADEDEEGLTVAAVTSGTG
EHMATTMASQKCADRIYQGTRRGPRGLDIADDDENAIMESFIAHDFMEHPGVKHCHASGAIGVMVVKKHHTGYYL
YFAHNTDSFALASMGGLDKKPHCTMSRLPEGCKIANGGRKIRIA*
Coding >Ophun1|2582
ATGATGGGTCGGAACCAGTGCGGCGCCGACGGCGTCCTCGATCGCGTGCTTCGCCTCAGCCAGAGGCAGACGTCT
GTGCCCGCCATATTCATTCACGCCGGTGCCGGTTTTCATAGCCGTCAGAACGAGACTGTTCATCTCAAAGCTTGC
GTCTCGGCGGCCGAGATGGGCATGCGCTTCCTCAAGGCCGGCGCTACCTCTACCGAGGCCGTCGAAGCCGCTCTT
CGAATACTAGAGGACAAGGAAATCACCAATGCCGGCTACGGCTCCAACCTGTCCATGGACGGCACCGTCGAGTGT
GACGCCACCATCGTTGACCATCTGGGACGCAGCGGAGCGTGCGGAGCCGTTCCCAATATCCGAAACCCAATCTCT
CTCGCCAAGCTCATTCTCGACACCAGCAACTTGCCCCTGAGCCTCCGCCGCGTGCCCCCAAACGCCCTGGTGGGA
GAGGGTGCCAGGGCATTCGCCGAGGAGCACGGAATGACGACGTTCGCCAACGAATATCTCGTCTCTACCAATTCT
CGTGATCGTTTCTATCGCTGGCAGGAGGATCTGCTGCGAGCCGAAGGGGGGGGCAAGGACGCGGCCGGTCTCGGC
CCTCATCTGACGCCTTCGAGAGCGGCCACGTGTATTCCTTGCCAGTACGACACGGCTCCGGCCGTTGATCCCCTC
AAGTCTTTTCCTCGCGAGCACGCGGCTGCCATCCTGACGGGCACGTGGAACGAAGGCCAGACGGATTCTCCTTAT
GCCGGCACGCCGGCGGTTGAATCGACCAATATGCCCGAATCGGCCATGTTCCCACCAACGACGGCCATGACGTTT
GCCGCTGCCGCACGCTCATCGCTGCAGATGCCCTCGCCGCAGCGTCCTATGGCCAAGGATAAGTCGAGAGTCGTC
GCCAAGCCCAACGACCTGTTCGCGCAGGAGATCAGAAGAAAGGTATCCAACGCAGAAGAGGAGCGCAAACAGTAC
CGATGCCCTCCGAACCACGCCGAGTCCGGTGATACGTCTTCGTCGGGCAACACGCGTCCCGAAGCCATGGCCCCG
CGCCGCCTTAAGCGGCCGGCCGAGACGACGACGCCGGACGGTGTCTCGCGTGGCCCCGGCCCCAAGCGCGTGCCG
TACTGGAACGTCGACAAAGACGACGCGGTGACGGACACTATCGGCGCCATCGCCATCGACGGCCGCGGCCACATC
GCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAGCATCGGGGAAGACTGGGTCCGGCCGCCATCGTCGGAGTC
GGAACCGCCGTCGTCCCCTGCGCCGACGAGGACGAAGAGGGACTCACGGTGGCGGCCGTGACGAGCGGAACAGGA
GAGCACATGGCGACCACCATGGCTTCGCAAAAGTGCGCCGACCGCATCTACCAGGGGACGCGTCGCGGGCCCCGT
GGCCTCGACATTGCCGACGACGACGAGAATGCCATTATGGAATCCTTCATCGCTCACGACTTTATGGAGCACCCG
GGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGCGTCATGGTGGTCAAGAAGCATCACACGGGCTACTATCTC
TACTTTGCCCACAATACCGACTCGTTCGCCCTGGCCTCCATGGGCGGTCTCGACAAGAAACCTCACTGCACCATG
TCCCGACTCCCCGAGGGCTGTAAGATTGCCAACGGAGGCCGCAAGATTCGAATCGCTTGA
Transcript >Ophun1|2582
ATGATGGGTCGGAACCAGTGCGGCGCCGACGGCGTCCTCGATCGCGTGCTTCGCCTCAGCCAGAGGCAGACGTCT
GTGCCCGCCATATTCATTCACGCCGGTGCCGGTTTTCATAGCCGTCAGAACGAGACTGTTCATCTCAAAGCTTGC
GTCTCGGCGGCCGAGATGGGCATGCGCTTCCTCAAGGCCGGCGCTACCTCTACCGAGGCCGTCGAAGCCGCTCTT
CGAATACTAGAGGACAAGGAAATCACCAATGCCGGCTACGGCTCCAACCTGTCCATGGACGGCACCGTCGAGTGT
GACGCCACCATCGTTGACCATCTGGGACGCAGCGGAGCGTGCGGAGCCGTTCCCAATATCCGAAACCCAATCTCT
CTCGCCAAGCTCATTCTCGACACCAGCAACTTGCCCCTGAGCCTCCGCCGCGTGCCCCCAAACGCCCTGGTGGGA
GAGGGTGCCAGGGCATTCGCCGAGGAGCACGGAATGACGACGTTCGCCAACGAATATCTCGTCTCTACCAATTCT
CGTGATCGTTTCTATCGCTGGCAGGAGGATCTGCTGCGAGCCGAAGGGGGGGGCAAGGACGCGGCCGGTCTCGGC
CCTCATCTGACGCCTTCGAGAGCGGCCACGTGTATTCCTTGCCAGTACGACACGGCTCCGGCCGTTGATCCCCTC
AAGTCTTTTCCTCGCGAGCACGCGGCTGCCATCCTGACGGGCACGTGGAACGAAGGCCAGACGGATTCTCCTTAT
GCCGGCACGCCGGCGGTTGAATCGACCAATATGCCCGAATCGGCCATGTTCCCACCAACGACGGCCATGACGTTT
GCCGCTGCCGCACGCTCATCGCTGCAGATGCCCTCGCCGCAGCGTCCTATGGCCAAGGATAAGTCGAGAGTCGTC
GCCAAGCCCAACGACCTGTTCGCGCAGGAGATCAGAAGAAAGGTATCCAACGCAGAAGAGGAGCGCAAACAGTAC
CGATGCCCTCCGAACCACGCCGAGTCCGGTGATACGTCTTCGTCGGGCAACACGCGTCCCGAAGCCATGGCCCCG
CGCCGCCTTAAGCGGCCGGCCGAGACGACGACGCCGGACGGTGTCTCGCGTGGCCCCGGCCCCAAGCGCGTGCCG
TACTGGAACGTCGACAAAGACGACGCGGTGACGGACACTATCGGCGCCATCGCCATCGACGGCCGCGGCCACATC
GCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAGCATCGGGGAAGACTGGGTCCGGCCGCCATCGTCGGAGTC
GGAACCGCCGTCGTCCCCTGCGCCGACGAGGACGAAGAGGGACTCACGGTGGCGGCCGTGACGAGCGGAACAGGA
GAGCACATGGCGACCACCATGGCTTCGCAAAAGTGCGCCGACCGCATCTACCAGGGGACGCGTCGCGGGCCCCGT
GGCCTCGACATTGCCGACGACGACGAGAATGCCATTATGGAATCCTTCATCGCTCACGACTTTATGGAGCACCCG
GGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGCGTCATGGTGGTCAAGAAGCATCACACGGGCTACTATCTC
TACTTTGCCCACAATACCGACTCGTTCGCCCTGGCCTCCATGGGCGGTCTCGACAAGAAACCTCACTGCACCATG
TCCCGACTCCCCGAGGGCTGTAAGATTGCCAACGGAGGCCGCAAGATTCGAATCGCTTGA
Gene >Ophun1|2582
ATGATGGGTCGGAACCAGTGCGGCGCCGACGGCGTCCTCGATCGCGTGCTTCGCCTCAGCCAGAGGCAGACGTCT
GTGCCCGCCATATTCATTCACGCCGGTGCCGGTTTTCATAGCCGTCAGAACGAGACTGTTCATCTCAAAGCTTGC
GTCTCGTCCGTCTGGCCCCCCCCAAAGGCAGTCCCTTGATGACGCTGACTCGAGATGCAACAGGGCGGCCGAGAT
GGGCATGCGCTTCCTCAAGGCCGGCGCTACCTCTACCGAGGCCGTCGAAGCCGCTCTTCGAATACTAGAGGACAA
GGAAATCACCAATGCCGGCTACGGCTCCAACCTGTCCATGGACGGCACCGTCGAGTGTGACGCCACCATCGTTGA
CCATCTGGGACGCAGCGGAGCGTGCGGAGCCGTTCCCAGTCAGACATGATTCCAGCCGTGACGCCTCGTGGCATG
GCTGACGATGACAGATATCCGAAACCCAATCTCTCTCGCCAAGCTCATTCTCGACACCAGCAACTTGCCCCTGAG
CCTCCGCCGCGTGCCCCCAAACGCCCTGGTGGGAGAGGGTGCCAGGGCATTCGCCGAGGAGCACGGAATGACGAC
GTTCGCCAACGAATATCTCGTCTCTACCAATTCTCGTGATCGTTTCTATCGCTGGCAGGAGGATCTGCTGCGAGC
CGAAGGGGGGGGCAAGGACGCGGCCGGTCTCGGCCCTCATCTGACGCCTTCGAGAGCGGCCACGTGTATTCCTTG
CCAGTACGACACGGCTCCGGCCGTTGATCCCCTCAAGTCTTTTCCTCGCGAGCACGCGGCTGCCATCCTGACGGG
CACGTGGAACGAAGGCCAGACGGATTCTCCTTATGCCGGCACGCCGGCGGTTGAATCGACCAATATGCCCGAATC
GGCCATGTTCCCACCAACGACGGCCATGACGTTTGCCGCTGCCGCACGCTCATCGCTGCAGATGCCCTCGCCGCA
GCGTCCTATGGCCAAGGATAAGTCGAGAGTCGTCGCCAAGCCCAACGACCTGTTCGCGCAGGAGATCAGAAGAAA
GGTATCCAACGCAGAAGAGGAGCGCAAACAGTACCGATGCCCTCCGAACCACGCCGAGTCCGGTGATACGTCTTC
GTCGGGCAACACGCGTCCCGAAGCCATGGCCCCGCGCCGCCTTAAGCGGCCGGCCGAGACGACGACGCCGGACGG
TGTCTCGCGTGGCCCCGGCCCCAAGCGCGTGCCGTACTGGAACGTCGACAAAGACGACGCGGTGACGGACACTAT
CGGCGCCATCGCCATCGACGGCCGCGGCCACATCGCTGCGGGCTCCTCGTCGGGAGGCATCGGCATGAAGCATCG
GGGAAGACTGGGTCCGGCCGCCATCGTCGGAGTCGGAACCGCCGTCGTCCCCTGCGCCGACGAGGACGAAGAGGG
ACTCACGGTGGCGGCCGTGACGAGCGGAACAGGAGAGCACATGGCGACCACCATGGCTTCGCAAAAGTGCGCCGA
CCGCATCTACCAGGGGACGCGTCGCGGGCCCCGTGGCCTCGACATTGCCGACGACGACGAGAATGCCATTATGGA
ATCCTTCATCGCTCACGACTTTATGGAGCACCCGGGCGTCAAGCACTGCCACGCCTCGGGCGCCATCGGCGTCAT
GGTGGTCAAGAAGCATCACACGGGCTACTATCTCTACTTTGCCCACAATACCGACTCGTTCGCCCTGGCCTCCAT
GGGCGGTCTCGACAAGAAACCTCACTGCACCATGTCCCGACTCCCCGAGGGCTGTAAGATTGCCAACGGAGGCCG
CAAGATTCGAATCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail