Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2570
Gene name
LocationContig_230:14..2148
Strand-
Gene length (bp)2134
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 9.7E-16 217 288
PF07885 Ion_trans_2 Ion channel 1.9E-17 376 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 6 519 6.0E-55
sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 352 435 5.0E-07
sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 351 452 6.0E-07
sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 180 347 6.0E-07
sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 352 437 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40310|TOK1_YEAST Outward-rectifier potassium channel TOK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOK1 PE=1 SV=1 6 519 6.0E-55
sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 352 435 5.0E-07
sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 351 452 6.0E-07
sp|O17185|SUP9_CAEEL Two pore potassium channel protein sup-9 OS=Caenorhabditis elegans GN=sup-9 PE=1 SV=2 180 347 6.0E-07
sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 352 437 8.0E-07
sp|O14649|KCNK3_HUMAN Potassium channel subfamily K member 3 OS=Homo sapiens GN=KCNK3 PE=1 SV=1 352 417 2.0E-06
sp|Q58752|MJK2_METJA Probable potassium channel protein 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1357 PE=3 SV=1 205 290 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 130 152 22
3 167 189 22
4 210 229 19
5 265 287 22
6 367 389 22
7 399 421 22
8 428 445 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2570
MVDSPLNDASDPLARVATSLLRPEFPLEARFQNDDAHLVPSRLWFASSAFPMAAGTLGPVASAFSICALVRQWRQ
HVPPGTDLDAGTFVPDPPWLLIINAIQLAVALVANIMLLLNMAKRVRFTIAQPITIVGWYISSILLIACTATASG
PLRHDLVPLDEYVWSQAFYYGIWAAILYFIVASLMAVTFCGAWSGHYDKDFNLTNSQRTLMLQTIAVLAYLLIGA
LVFSKIEDWPYLDAVYWADVTLFTIGFGDFAPKTQLGRGLLIPYALVGIISVGLVISSISSLMLERGSRRLDARM
EEKRRRKVITAMTRKGDDDVLTPLPPGPISNMRVSDDPLADEFDRRRCEFELMRMIQKTASSRRRWLAMATSFSL
WVVLWLVGAAVFYACEWSYQHWTYFEAFYYCFISLLTIGYGDLHVVSNAGRSFFVFWSLMALPTMTVLISNAGDT
VVKLVNDYTNYLGNLTILPGDEPLGRTLKRIVHSISCGRLFSSVNRAAPDPQRLDGVNEKTDQPWGDVQATAKTP
ASPSLSRALSVMRNSAGVLLPTNTAASTSLSRAMTAVQNTTGVLIPTNTVERQSLNRVHDILGALPTGNDFHLLL
ITEIQSVAKHLREDEPRRYSFEEWAWKSASTHATATTRTSTDTPGITTTASARPTPPQPHPPRPSPSSTTMA*
Coding >Ophun1|2570
ATGGTCGATAGTCCGCTCAACGACGCCTCTGATCCCCTGGCCCGCGTTGCCACGTCTCTTCTGCGGCCTGAGTTC
CCTCTCGAGGCTCGCTTTCAGAATGACGACGCTCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGCTGCCGGCACCTTGGGACCAGTCGCTTCAGCCTTCAGCATCTGCGCCCTTGTGCGCCAATGGCGACAG
CATGTTCCGCCTGGGACCGACCTCGACGCCGGAACCTTTGTGCCCGATCCTCCCTGGCTTCTCATCATCAACGCC
ATTCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTCCTCAACATGGCAAAGAGGGTGCGCTTCACTATT
GCGCAGCCCATCACCATTGTCGGCTGGTACATCTCCTCTATTCTCCTCATTGCCTGTACCGCCACCGCCAGCGGC
CCCTTGAGACATGACCTCGTCCCTCTCGACGAATACGTTTGGTCCCAAGCCTTTTACTATGGCATCTGGGCCGCC
ATCCTCTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACTAACAGCCAGCGCACCCTCATGCTGCAGACCATTGCCGTCTTGGCCTACCTGCTCATCGGCGCC
CTCGTCTTCTCCAAGATCGAGGACTGGCCCTACCTCGACGCCGTCTACTGGGCCGACGTGACTCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCTAAGACGCAGCTCGGCCGTGGCCTGTTGATTCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGTTGGAGCGTGGCAGCCGTCGACTCGATGCCCGTATG
GAGGAAAAGCGTCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGTGACGACGACGTACTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGATCGCCGCCGCTGCGAGTTC
GAGCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCACCTCTTTTAGCCTC
TGGGTCGTCCTCTGGCTCGTGGGTGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTT
GAGGCCTTTTACTACTGCTTCATCTCGCTGCTGACCATCGGCTACGGCGACCTCCACGTCGTCTCCAACGCCGGC
CGCTCATTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCTACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCGTCAACGACTACACAAACTATCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CGCACCCTAAAGCGCATCGTCCACAGCATCAGCTGCGGCCGCCTCTTCTCCAGCGTCAACCGCGCCGCCCCCGAC
CCCCAGCGCCTCGATGGCGTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGCCAAGACGCCC
GCAAGCCCCAGCCTCTCACGCGCCCTCTCCGTCATGCGCAACAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCACCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACTACAGGCGTCCTCATACCCACCAACACGGTA
GAACGCCAGTCCCTAAACCGCGTCCACGACATCCTCGGCGCCCTCCCCACCGGCAACGACTTCCACCTCCTCCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGAAGAGCGCAAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCTGGCATCACCACCACAGCC
AGCGCGAGACCGACGCCCCCACAGCCTCATCCGCCCCGGCCCTCGCCCTCGTCGACGACGATGGCGTAG
Transcript >Ophun1|2570
ATGGTCGATAGTCCGCTCAACGACGCCTCTGATCCCCTGGCCCGCGTTGCCACGTCTCTTCTGCGGCCTGAGTTC
CCTCTCGAGGCTCGCTTTCAGAATGACGACGCTCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGCTGCCGGCACCTTGGGACCAGTCGCTTCAGCCTTCAGCATCTGCGCCCTTGTGCGCCAATGGCGACAG
CATGTTCCGCCTGGGACCGACCTCGACGCCGGAACCTTTGTGCCCGATCCTCCCTGGCTTCTCATCATCAACGCC
ATTCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTCCTCAACATGGCAAAGAGGGTGCGCTTCACTATT
GCGCAGCCCATCACCATTGTCGGCTGGTACATCTCCTCTATTCTCCTCATTGCCTGTACCGCCACCGCCAGCGGC
CCCTTGAGACATGACCTCGTCCCTCTCGACGAATACGTTTGGTCCCAAGCCTTTTACTATGGCATCTGGGCCGCC
ATCCTCTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACTAACAGCCAGCGCACCCTCATGCTGCAGACCATTGCCGTCTTGGCCTACCTGCTCATCGGCGCC
CTCGTCTTCTCCAAGATCGAGGACTGGCCCTACCTCGACGCCGTCTACTGGGCCGACGTGACTCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCTAAGACGCAGCTCGGCCGTGGCCTGTTGATTCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGTTGGAGCGTGGCAGCCGTCGACTCGATGCCCGTATG
GAGGAAAAGCGTCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGTGACGACGACGTACTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGATCGCCGCCGCTGCGAGTTC
GAGCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCACCTCTTTTAGCCTC
TGGGTCGTCCTCTGGCTCGTGGGTGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTT
GAGGCCTTTTACTACTGCTTCATCTCGCTGCTGACCATCGGCTACGGCGACCTCCACGTCGTCTCCAACGCCGGC
CGCTCATTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCTACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCGTCAACGACTACACAAACTATCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CGCACCCTAAAGCGCATCGTCCACAGCATCAGCTGCGGCCGCCTCTTCTCCAGCGTCAACCGCGCCGCCCCCGAC
CCCCAGCGCCTCGATGGCGTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGCCAAGACGCCC
GCAAGCCCCAGCCTCTCACGCGCCCTCTCCGTCATGCGCAACAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCACCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACTACAGGCGTCCTCATACCCACCAACACGGTA
GAACGCCAGTCCCTAAACCGCGTCCACGACATCCTCGGCGCCCTCCCCACCGGCAACGACTTCCACCTCCTCCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGAAGAGCGCAAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCTGGCATCACCACCACAGCC
AGCGCGAGACCGACGCCCCCACAGCCTCATCCGCCCCGGCCCTCGCCCTCGTCGACGACGATGGCGTAG
Gene >Ophun1|2570
ATGGTCGATAGTCCGCTCAACGACGCCTCTGATCCCCTGGCCCGCGTTGCCACGTCTCTTCTGCGGCCTGAGTTC
CCTCTCGAGGCTCGCTTTCAGAATGACGACGCTCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGCTGCCGGCACCTTGGGACCAGTCGCTTCAGCCTTCAGCATCTGCGCCCTTGTGCGCCAATGGCGACAG
CATGTTCCGCCTGGGACCGACCTCGACGCCGGAACCTTTGTGCCCGATCCTCCCTGGTAAGAGGAGCGCCATACC
TACCAGTATCGTCCGCTGCTGACTTTGGTTAGGCTTCTCATCATCAACGCCATTCAGCTGGCCGTTGCCCTAGTC
GCCAACATCATGCTCCTCCTCAACATGGCAAAGAGGGTGCGCTTCACTATTGCGCAGCCCATCACCATTGTCGGC
TGGTACATCTCCTCTATTCTCCTCATTGCCTGTACCGCCACCGCCAGCGGCCCCTTGAGACATGACCTCGTCCCT
CTCGACGAATACGTTTGGTCCCAAGCCTTTTACTATGGCATCTGGGCCGCCATCCTCTACTTCATCGTCGCCTCC
CTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGACTTTAACCTGACTAACAGCCAGCGC
ACCCTCATGCTGCAGACCATTGCCGTCTTGGCCTACCTGCTCATCGGCGCCCTCGTCTTCTCCAAGATCGAGGAC
TGGCCCTACCTCGACGCCGTCTACTGGGCCGACGTGACTCTCTTCACCATCGGCTTCGGAGACTTTGCGCCTAAG
ACGCAGCTCGGCCGTGGCCTGTTGATTCCCTACGCGCTCGTCGGCATCATCAGCGTCGGTCTCGTCATCAGTTCC
ATCAGCAGCCTGATGTTGGAGCGTGGCAGCCGTCGACTCGATGCCCGTATGGAGGAAAAGCGTCGACGGAAAGTC
ATAACCGCCATGACTCGCAAGGGTGACGACGACGTACTGACTCCCCTGCCCCCGGGCCCCATCAGCAACATGAGG
GTGTCGGACGATCCGCTGGCCGACGAGTTCGATCGCCGCCGCTGCGAGTTCGAGCTGATGCGCATGATACAGAAG
ACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCACCTCTTTTAGCCTCTGGGTCGTCCTCTGGCTCGTGGGT
GCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTTGAGGCCTTTTACTACTGCTTCATC
TCGCTGCTGACCATCGGCTACGGCGACCTCCACGTCGTCTCCAACGCCGGCCGCTCATTCTTCGTCTTCTGGTCG
CTCATGGCGCTGCCTACCATGACGGTCCTCATCTCCAACGCCGGAGACACCGTCGTCAAGCTCGTCAACGACTAC
ACAAACTATCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGCCGCACCCTAAAGCGCATCGTCCAC
AGCATCAGCTGCGGCCGCCTCTTCTCCAGCGTCAACCGCGCCGCCCCCGACCCCCAGCGCCTCGATGGCGTAAAC
GAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGCCAAGACGCCCGCAAGCCCCAGCCTCTCACGCGCC
CTCTCCGTCATGCGCAACAGCGCCGGCGTCCTCCTGCCCACCAACACAGCCGCCAGCACCAGCCTCTCGCGCGCA
ATGACGGCCGTCCAGAACACTACAGGCGTCCTCATACCCACCAACACGGTAGAACGCCAGTCCCTAAACCGCGTC
CACGACATCCTCGGCGCCCTCCCCACCGGCAACGACTTCCACCTCCTCCTCATCACCGAGATCCAATCGGTAGCC
AAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCCTGGTACCTAGGCCTCATAGGCGAA
GACGAGCGCAAGCCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGCAAGCACCCACGCCACCGCCACCAC
CCGCACAAGCACAGACACGCCTGGCATCACCACCACAGCCAGCGCGAGACCGACGCCCCCACAGCCTCATCCGCC
CCGGCCCTCGCCCTCGTCGACGACGATGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail