Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2562
Gene name
LocationContig_23:46892..48581
Strand-
Gene length (bp)1689
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02434 Fringe Fringe-like 2.6E-06 273 365

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2562
MRSPFVRALVAALCVLLVLMAFMRSDSVPVHNHLFGKATLKSSLAHQELSQQGPSPQSQQQQQQREQQQHQQPLE
NKKRPFAHLPSFLSAQRPATTGSPIINCTVDVPHLTDIKNRYELDDKFQYLKRYVRFTRKQGLERKRLTKLSGDL
ILGPLKTIDLNKQYSPEACPAPLEVPVTASPMPSTVNASDFMFGVSTTYQRFMDANTTPINEWIFWLTDGRGRSN
GGKLLLMLLDASDEELQEVANLLGDVGIDVDVYHSNSAVEMAVRYLTLVPTLYTHGDAQNKKWLVTCDDDTFFPS
MHGLIEKINSFDHTRQMYIGTLSEDVGAIERHGSQAFGGAGVFLSLPMAKLISERFGVCTSEQKVLESNSGWGPQ
GDIMLRKCIYENSETRLTNVWDLWQLDFFGHPAGFYEWGIKPLSLHHYRGGGWHKAKPGQFTKIAHTCGEDCTLQ
RFQTADDFVISGYSIAHYPQGIDFDINQMEATLHAAPENKGWNLDFIFGPQRPALEKTGRKIAWELQESEVRSDG
SVLQTYTRKQNDGRWLNKNGQSMSNIDGVFELVWIPA*
Coding >Ophun1|2562
ATGCGGAGTCCTTTTGTTCGCGCCCTCGTTGCCGCCTTGTGCGTGCTGCTCGTCCTCATGGCCTTCATGCGTTCC
GACTCGGTGCCCGTCCACAACCACCTCTTCGGCAAGGCGACCCTCAAGTCGTCTCTGGCCCATCAAGAGCTGTCT
CAACAGGGGCCGTCGCCGCAGAGTCAACAACAGCAGCAACAGCGGGAGCAGCAGCAACACCAACAACCCCTCGAG
AACAAGAAGCGTCCCTTCGCCCACCTACCCTCCTTCTTGTCCGCCCAACGTCCCGCTACGACCGGCTCTCCCATC
ATCAACTGCACCGTCGATGTGCCTCACCTGACCGACATCAAGAACCGCTACGAACTCGATGACAAGTTTCAGTAC
CTAAAGCGCTATGTCCGCTTCACCCGCAAGCAGGGCTTGGAACGCAAGCGCCTCACCAAGCTGTCGGGCGATCTG
ATCCTTGGCCCCCTCAAGACGATCGATCTCAACAAGCAGTATTCTCCCGAGGCGTGTCCTGCCCCCCTCGAGGTC
CCCGTCACCGCCTCTCCCATGCCGTCAACCGTCAACGCTTCCGACTTCATGTTCGGCGTTTCCACCACCTACCAG
CGCTTCATGGACGCCAACACGACGCCCATCAACGAGTGGATCTTCTGGCTCACCGATGGCCGTGGCCGCTCCAAC
GGGGGAAAGCTGCTACTGATGCTCCTGGACGCTAGTGACGAGGAGCTGCAAGAGGTGGCCAACCTGCTCGGCGAC
GTCGGCATCGATGTCGACGTCTACCACTCCAACTCGGCCGTCGAGATGGCTGTGCGCTATCTTACCCTCGTTCCC
ACCCTCTACACCCACGGCGACGCCCAAAACAAGAAGTGGCTAGTCACGTGTGACGACGACACCTTCTTCCCCAGC
ATGCACGGTCTCATCGAAAAGATCAACAGTTTCGACCACACGAGACAGATGTACATTGGCACCTTGTCCGAGGAT
GTTGGAGCCATCGAACGTCACGGCTCGCAGGCCTTTGGCGGCGCTGGCGTCTTCCTGTCGTTGCCCATGGCCAAG
CTCATCTCGGAACGCTTCGGCGTCTGCACCTCGGAGCAAAAGGTGCTTGAATCCAACTCGGGCTGGGGTCCCCAG
GGCGACATCATGCTCCGGAAATGCATCTACGAGAATTCCGAGACGCGTCTGACCAACGTCTGGGACCTTTGGCAG
CTCGATTTCTTCGGACACCCGGCTGGCTTTTACGAATGGGGCATTAAGCCTCTGTCTCTGCACCACTATCGCGGT
GGCGGCTGGCACAAGGCCAAGCCCGGTCAGTTCACCAAGATCGCCCATACCTGCGGCGAGGACTGCACCCTGCAG
AGATTCCAGACGGCCGACGACTTCGTCATTTCGGGTTACTCCATCGCCCACTACCCGCAGGGCATAGACTTTGAC
ATTAATCAGATGGAGGCCACCCTCCATGCCGCACCCGAGAACAAGGGCTGGAACCTCGACTTCATATTTGGCCCT
CAAAGGCCGGCGCTTGAGAAGACGGGACGCAAGATTGCCTGGGAACTGCAAGAGTCCGAGGTCCGGTCCGACGGC
TCCGTGCTGCAGACGTATACGAGGAAGCAGAACGACGGCCGCTGGTTGAACAAGAACGGTCAATCGATGAGCAAC
ATTGACGGCGTCTTCGAGCTAGTCTGGATACCCGCTTAG
Transcript >Ophun1|2562
ATGCGGAGTCCTTTTGTTCGCGCCCTCGTTGCCGCCTTGTGCGTGCTGCTCGTCCTCATGGCCTTCATGCGTTCC
GACTCGGTGCCCGTCCACAACCACCTCTTCGGCAAGGCGACCCTCAAGTCGTCTCTGGCCCATCAAGAGCTGTCT
CAACAGGGGCCGTCGCCGCAGAGTCAACAACAGCAGCAACAGCGGGAGCAGCAGCAACACCAACAACCCCTCGAG
AACAAGAAGCGTCCCTTCGCCCACCTACCCTCCTTCTTGTCCGCCCAACGTCCCGCTACGACCGGCTCTCCCATC
ATCAACTGCACCGTCGATGTGCCTCACCTGACCGACATCAAGAACCGCTACGAACTCGATGACAAGTTTCAGTAC
CTAAAGCGCTATGTCCGCTTCACCCGCAAGCAGGGCTTGGAACGCAAGCGCCTCACCAAGCTGTCGGGCGATCTG
ATCCTTGGCCCCCTCAAGACGATCGATCTCAACAAGCAGTATTCTCCCGAGGCGTGTCCTGCCCCCCTCGAGGTC
CCCGTCACCGCCTCTCCCATGCCGTCAACCGTCAACGCTTCCGACTTCATGTTCGGCGTTTCCACCACCTACCAG
CGCTTCATGGACGCCAACACGACGCCCATCAACGAGTGGATCTTCTGGCTCACCGATGGCCGTGGCCGCTCCAAC
GGGGGAAAGCTGCTACTGATGCTCCTGGACGCTAGTGACGAGGAGCTGCAAGAGGTGGCCAACCTGCTCGGCGAC
GTCGGCATCGATGTCGACGTCTACCACTCCAACTCGGCCGTCGAGATGGCTGTGCGCTATCTTACCCTCGTTCCC
ACCCTCTACACCCACGGCGACGCCCAAAACAAGAAGTGGCTAGTCACGTGTGACGACGACACCTTCTTCCCCAGC
ATGCACGGTCTCATCGAAAAGATCAACAGTTTCGACCACACGAGACAGATGTACATTGGCACCTTGTCCGAGGAT
GTTGGAGCCATCGAACGTCACGGCTCGCAGGCCTTTGGCGGCGCTGGCGTCTTCCTGTCGTTGCCCATGGCCAAG
CTCATCTCGGAACGCTTCGGCGTCTGCACCTCGGAGCAAAAGGTGCTTGAATCCAACTCGGGCTGGGGTCCCCAG
GGCGACATCATGCTCCGGAAATGCATCTACGAGAATTCCGAGACGCGTCTGACCAACGTCTGGGACCTTTGGCAG
CTCGATTTCTTCGGACACCCGGCTGGCTTTTACGAATGGGGCATTAAGCCTCTGTCTCTGCACCACTATCGCGGT
GGCGGCTGGCACAAGGCCAAGCCCGGTCAGTTCACCAAGATCGCCCATACCTGCGGCGAGGACTGCACCCTGCAG
AGATTCCAGACGGCCGACGACTTCGTCATTTCGGGTTACTCCATCGCCCACTACCCGCAGGGCATAGACTTTGAC
ATTAATCAGATGGAGGCCACCCTCCATGCCGCACCCGAGAACAAGGGCTGGAACCTCGACTTCATATTTGGCCCT
CAAAGGCCGGCGCTTGAGAAGACGGGACGCAAGATTGCCTGGGAACTGCAAGAGTCCGAGGTCCGGTCCGACGGC
TCCGTGCTGCAGACGTATACGAGGAAGCAGAACGACGGCCGCTGGTTGAACAAGAACGGTCAATCGATGAGCAAC
ATTGACGGCGTCTTCGAGCTAGTCTGGATACCCGCTTAG
Gene >Ophun1|2562
ATGCGGAGTCCTTTTGTTCGCGCCCTCGTTGCCGCCTTGTGCGTGCTGCTCGTCCTCATGGCCTTCATGCGTTCC
GACTCGGTGCCCGTCCACAACCACCTCTTCGGCAAGGCGACCCTCAAGTCGTCTCTGGCCCATCAAGAGCTGTCT
CAACAGGGGCCGTCGCCGCAGAGTCAACAACAGCAGCAACAGCGGGAGCAGCAGCAACACCAACAACCCCTCGAG
AACAAGAAGCGTCCCTTCGCCCACCTACCCTCCTTCTTGTCCGCCCAACGTCCCGCTACGACCGGCTCTCCCATC
ATCAACTGCACCGTCGATGTGCCTCACCTGACCGACATCAAGAACCGCTACGAACTCGATGACAAGTTTCAGTAC
CTAAAGCGCTATGTCCGCTTCACCCGCAAGCAGGGCTTGGAACGCAAGCGCCTCACCAAGCTGTCGGGCGATCTG
ATCCTTGGCCCCCTCAAGACGATCGATCTCAACAAGCAGTATTCTCCCGAGGCGTGTCCTGCCCCCCTCGAGGTC
CCCGTCACCGCCTCTCCCATGCCGTCAACCGTCAACGCTTCCGACTTCATGTTCGGCGTTTCCACCACCTACCAG
CGCTTCATGGACGCCAACACGACGCCCATCAACGAGTGGATCTTCTGGCTCACCGATGGCCGTGGCCGCTCCAAC
GGGGGAAAGCTGCTACTGATGCTCCTGGACGCTAGTGACGAGGAGCTGCAAGAGGTGGCCAACCTGCTCGGCGAC
GTCGGCATCGATGTCGACGTCTACCACTCCAACTCGGCCGTCGAGATGGCTGTGCGCTATCTTACCCTCGTTCCC
ACCCTCTACACCCACGGCGACGCCCAAAACAAGAAGTGGCTAGTCACGTGTGACGACGACACCTTCTTCCCCAGC
ATGCACGGTCTCATCGAAAAGATCAACAGTTTCGACCACACGAGACAGATGTACATTGGCACCTTGTCCGAGGAT
GTTGGAGCCATCGAACGTCACGGCTCGCAGGCCTTTGGCGGCGCTGGCGTCTTCCTGTCGTTGCCCATGGCCAAG
CTCATCTCGGAACGCTTCGGCGTCTGCACCTCGGAGCAAAAGGTGCTTGAATCCAACTCGGGCTGGGGTCCCCAG
GGCGACATCATGCTCCGGAAATGCATCTACGAGAATTCCGAGACGCGTCTGACCAACGTCTGGGACCTTTGGCAG
CTCGATTTCTTCGGACACCCGGCTGGCTTTTACGAATGGGGCATTAAGCCTCTGTCTCTGCACCACTATCGCGGT
GGCGGCTGGCACAAGGCCAAGCCCGGTCAGTTCACCAAGATCGCCCATACCTGCGGCGAGGACTGCACCCTGCAG
AGATTCCAGACGGCCGACGACTTCGTCATTTCGGGTTACTCCATCGCCCACTACCCGCAGGGCATAGACTTTGAC
ATTAATCAGATGGAGGCCACCCTCCATGCCGCACCCGAGAACAAGGGCTGGAACCTCGACTTCATATTTGGCCCT
CAAAGGCCGGCGCTTGAGAAGACGGGACGCAAGATTGCCTGGGAACTGCAAGAGTCCGAGGTCCGGTCCGACGGC
TCCGTGCTGCAGACGTATACGAGGAAGCAGAACGACGGCCGCTGGTTGAACAAGAACGGTCAATCGATGAGCAAC
ATTGACGGCGTCTTCGAGCTAGTCTGGATACCCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail