Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2557
Gene name
LocationContig_23:23780..25588
Strand+
Gene length (bp)1808
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 9.0E-29 50 156

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 488 510 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2557
MSEIQQPLHPSGYDEVQPRDLNHRTPSPEPYKAAQPDPYTSSVLFVGMMALFYFVDNKLLSEWNLPVTPSWIIDN
LMSACSAALMHNVSSCIGQLKWLHFSQRPHQLYNLERFDEASRGPYGSVSFLMRVKWNMASIGALVTIFRLAFFP
LAQQAIGVKYAYAVVNNGSTHSVPTFGYLHTYKQNMTYESLTGVYIDELRQDPLMQSAILQGIYNISTPPIFSCS
GSCQWRQPYISLGFKTVCENVTAATLGSQRCGKASTAHYSGFKLCNMTTPQGTRIQTRFSSTSFATTFRLNATSP
DVIEGTGSGDVWSAAARDFPNLLKFAVYRATPITTFSGPSTEVVNENVTACTLSLTAYNYSSAHSNGSDFRFGTV
REIELPAEGWHRQSQDTGIRFRGPGLELEIGILEVVTLQTYFKSSMISSEWVDGESYHNTNWGISMALMGDVNLP
ARFDKMAASMTDYLRSSSNRLEAHGENVQWVASFDVRWLVLLGPAAVQLAVLVFTTLTVAHNRRNRNVPLWKSSA
LAILSCVHDGGSGSLRGGFRDVREMRKVARESFVRLE*
Coding >Ophun1|2557
ATGTCCGAGATCCAACAGCCACTTCATCCGAGCGGGTACGACGAGGTGCAGCCTCGCGACCTGAACCACAGGACG
CCGTCTCCAGAACCCTACAAGGCCGCTCAGCCTGATCCTTACACGAGCTCTGTGCTCTTTGTCGGCATGATGGCC
CTCTTTTATTTCGTTGACAACAAGCTTCTCTCGGAATGGAATCTCCCCGTCACTCCCAGCTGGATCATTGACAAT
CTAATGAGTGCCTGCTCGGCAGCGTTGATGCACAATGTCAGCTCATGCATCGGCCAGCTGAAATGGCTGCACTTT
AGCCAGAGGCCTCATCAGCTGTACAACCTGGAGAGATTCGACGAAGCCAGCCGAGGCCCTTACGGATCCGTCTCC
TTCTTGATGCGAGTCAAGTGGAATATGGCATCGATTGGCGCCTTGGTCACCATCTTCCGACTTGCCTTCTTTCCT
CTTGCTCAGCAGGCCATCGGCGTCAAGTATGCCTACGCTGTTGTCAATAACGGCAGTACGCATAGCGTCCCGACA
TTCGGTTACCTGCATACATACAAGCAGAACATGACTTACGAGAGCCTTACTGGCGTCTACATCGATGAGCTGCGA
CAAGATCCTCTGATGCAGTCGGCCATTCTTCAAGGCATCTATAATATCTCGACGCCTCCGATCTTTAGCTGCAGC
GGGTCTTGCCAATGGAGACAGCCGTACATATCTCTCGGCTTCAAGACTGTTTGTGAGAATGTCACAGCGGCCACC
TTGGGCTCCCAGAGGTGTGGTAAGGCTAGTACAGCACATTACAGCGGTTTCAAATTGTGCAACATGACGACTCCT
CAAGGAACGCGCATCCAGACCAGGTTTTCGTCAACCAGTTTTGCTACCACCTTCCGGCTCAACGCCACATCACCC
GATGTTATCGAAGGCACCGGCTCAGGCGATGTCTGGTCAGCGGCTGCCCGAGACTTTCCGAATCTGCTGAAATTC
GCCGTCTACAGAGCAACGCCCATTACCACCTTTTCCGGCCCTTCGACTGAAGTAGTTAATGAGAACGTAACGGCT
TGCACCTTGAGCCTCACGGCGTATAATTACTCGAGCGCGCATTCCAATGGCAGCGACTTTCGCTTCGGCACCGTC
CGCGAGATCGAGCTGCCAGCAGAAGGGTGGCATCGACAATCGCAAGACACAGGCATCAGGTTCAGAGGACCGGGT
TTGGAGCTTGAGATTGGCATTCTCGAAGTCGTTACGCTGCAGACCTACTTTAAGTCGAGCATGATTTCGTCCGAG
TGGGTGGACGGCGAGAGCTACCACAACACCAACTGGGGCATCAGCATGGCTCTGATGGGCGACGTCAATCTCCCT
GCTCGGTTCGACAAGATGGCCGCCAGCATGACCGACTATCTGCGATCGTCGTCGAACAGGCTGGAGGCACATGGC
GAGAATGTCCAGTGGGTCGCCTCGTTTGACGTGCGTTGGCTGGTGCTGCTGGGGCCGGCGGCGGTACAGCTAGCC
GTGCTGGTATTTACCACCCTGACCGTGGCTCACAACCGGAGGAACCGAAACGTGCCGCTGTGGAAGTCGTCGGCG
CTGGCGATCTTGTCTTGTGTTCACGATGGGGGGTCTGGCTCGCTGCGGGGTGGGTTCAGGGATGTACGGGAGATG
CGCAAGGTTGCGAGGGAGTCGTTTGTGCGGCTTGAGTAG
Transcript >Ophun1|2557
ATGTCCGAGATCCAACAGCCACTTCATCCGAGCGGGTACGACGAGGTGCAGCCTCGCGACCTGAACCACAGGACG
CCGTCTCCAGAACCCTACAAGGCCGCTCAGCCTGATCCTTACACGAGCTCTGTGCTCTTTGTCGGCATGATGGCC
CTCTTTTATTTCGTTGACAACAAGCTTCTCTCGGAATGGAATCTCCCCGTCACTCCCAGCTGGATCATTGACAAT
CTAATGAGTGCCTGCTCGGCAGCGTTGATGCACAATGTCAGCTCATGCATCGGCCAGCTGAAATGGCTGCACTTT
AGCCAGAGGCCTCATCAGCTGTACAACCTGGAGAGATTCGACGAAGCCAGCCGAGGCCCTTACGGATCCGTCTCC
TTCTTGATGCGAGTCAAGTGGAATATGGCATCGATTGGCGCCTTGGTCACCATCTTCCGACTTGCCTTCTTTCCT
CTTGCTCAGCAGGCCATCGGCGTCAAGTATGCCTACGCTGTTGTCAATAACGGCAGTACGCATAGCGTCCCGACA
TTCGGTTACCTGCATACATACAAGCAGAACATGACTTACGAGAGCCTTACTGGCGTCTACATCGATGAGCTGCGA
CAAGATCCTCTGATGCAGTCGGCCATTCTTCAAGGCATCTATAATATCTCGACGCCTCCGATCTTTAGCTGCAGC
GGGTCTTGCCAATGGAGACAGCCGTACATATCTCTCGGCTTCAAGACTGTTTGTGAGAATGTCACAGCGGCCACC
TTGGGCTCCCAGAGGTGTGGTAAGGCTAGTACAGCACATTACAGCGGTTTCAAATTGTGCAACATGACGACTCCT
CAAGGAACGCGCATCCAGACCAGGTTTTCGTCAACCAGTTTTGCTACCACCTTCCGGCTCAACGCCACATCACCC
GATGTTATCGAAGGCACCGGCTCAGGCGATGTCTGGTCAGCGGCTGCCCGAGACTTTCCGAATCTGCTGAAATTC
GCCGTCTACAGAGCAACGCCCATTACCACCTTTTCCGGCCCTTCGACTGAAGTAGTTAATGAGAACGTAACGGCT
TGCACCTTGAGCCTCACGGCGTATAATTACTCGAGCGCGCATTCCAATGGCAGCGACTTTCGCTTCGGCACCGTC
CGCGAGATCGAGCTGCCAGCAGAAGGGTGGCATCGACAATCGCAAGACACAGGCATCAGGTTCAGAGGACCGGGT
TTGGAGCTTGAGATTGGCATTCTCGAAGTCGTTACGCTGCAGACCTACTTTAAGTCGAGCATGATTTCGTCCGAG
TGGGTGGACGGCGAGAGCTACCACAACACCAACTGGGGCATCAGCATGGCTCTGATGGGCGACGTCAATCTCCCT
GCTCGGTTCGACAAGATGGCCGCCAGCATGACCGACTATCTGCGATCGTCGTCGAACAGGCTGGAGGCACATGGC
GAGAATGTCCAGTGGGTCGCCTCGTTTGACGTGCGTTGGCTGGTGCTGCTGGGGCCGGCGGCGGTACAGCTAGCC
GTGCTGGTATTTACCACCCTGACCGTGGCTCACAACCGGAGGAACCGAAACGTGCCGCTGTGGAAGTCGTCGGCG
CTGGCGATCTTGTCTTGTGTTCACGATGGGGGGTCTGGCTCGCTGCGGGGTGGGTTCAGGGATGTACGGGAGATG
CGCAAGGTTGCGAGGGAGTCGTTTGTGCGGCTTGAGTAG
Gene >Ophun1|2557
ATGTCCGAGATCCAACAGCCACTTCATCCGAGCGGGTACGACGAGGTGCAGCCTCGCGACCTGAACCACAGGACG
CCGTCTCCAGAACCCTACAAGGCCGCTCAGCCTGATCCTTACACGAGGTATCGAATAACGTCCTCGGATGAATGG
GGCTTGGAGATTCTCCTTTGTCTCGTCAGCTCTGTGCTCTTTGTCGGCATGATGGCCCTCTTTTATTTCGTTGAC
AACAAGCTTCTCTCGGAATGGAATCTCCCCGTCACTCCCAGCTGGATCATTGACAATCTAATGAGTGCCTGCTCG
GCAGCGTTGATGCACAATGTCAGCTCATGCATCGGCCAGCTGAAATGGCTGCACTTTAGCCAGAGGCCTCATCAG
CTGTACAACCTGGAGAGATTCGACGAAGCCAGCCGAGGCCCTTACGGATCCGTCTCCTTCTTGATGCGAGTCAAG
TGGAATATGGCATCGATTGGCGCCTTGGTCACCATCTTCCGACTTGCCTTCTTTCCTCTTGCTCAGCAGGCCATC
GGCGTCAAGTATGCCTACGCTGTTGTCAATAACGGCAGTACGCATAGCGTCCCGACATTCGGTTACCTGCATACA
TACAAGCAGAACATGACTTACGAGAGCCTTACTGGCGTCTACATCGGTGAGTTGCGCCGCGATGTTAATGAAAGT
CTTCTTTGAGTCGAGAAATAACACGTGACATAGATGAGCTGCGACAAGATCCTCTGATGCAGTCGGCCATTCTTC
AAGGCATCTATAATATCTCGACGCCTCCGATCTTTAGCTGCAGCGGGTCTTGCCAATGGAGACAGCCGTACATAT
CTCTCGGCTTCAAGACTGTTTGTGAGAATGTCACAGCGGCCACCTTGGGCTCCCAGAGGTGTGGTAAGGCTAGTA
CAGCACATTACAGCGGTTTCAAATTGTGCAACATGACGACTCCTCAAGGAACGCGCATCCAGACCAGGTTTTCGT
CAACCAGTTTTGCTACCACCTTCCGGCTCAACGCCACATCACCCGATGTTATCGAAGGCACCGGCTCAGGCGATG
TCTGGTCAGCGGCTGCCCGAGACTTTCCGAATCTGCTGAAATTCGCCGTCTACAGAGCAACGCCCATTACCACCT
TTTCCGGCCCTTCGACTGAAGTAGTTAATGAGAACGTAACGGCTTGCACCTTGAGCCTCACGGCGTATAATTACT
CGAGCGCGCATTCCAATGGCAGCGACTTTCGCTTCGGCACCGTCCGCGAGATCGAGCTGCCAGCAGAAGGGTGGC
ATCGACAATCGCAAGACACAGGCATCAGGTTCAGAGGACCGGGTTTGGAGCTTGAGATTGGCATTCTCGAAGTCG
TTACGCTGCAGACCTACTTTAAGTCGAGCATGATTTCGTCCGAGTGGGTGGACGGCGAGAGCTACCACAACACCA
ACTGGGGCATCAGCATGGCTCTGATGGGCGACGTCAATCTCCCTGCTCGGTTCGACAAGATGGCCGCCAGCATGA
CCGACTATCTGCGATCGTCGTCGAACAGGCTGGAGGCACATGGCGAGAATGTCCAGTGGGTCGCCTCGTTTGACG
TGCGTTGGCTGGTGCTGCTGGGGCCGGCGGCGGTACAGCTAGCCGTGCTGGTATTTACCACCCTGACCGTGGCTC
ACAACCGGAGGAACCGAAACGTGCCGCTGTGGAAGTCGTCGGCGCTGGCGATCTTGTCTTGTGTTCACGATGGGG
GGTCTGGCTCGCTGCGGGGTGGGTTCAGGGATGTACGGGAGATGCGCAAGGTTGCGAGGGAGTCGTTTGTGCGGC
TTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail