Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2553
Gene name
LocationContig_23:17585..18043
Strand-
Gene length (bp)458
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00203 Ribosomal_S19 Ribosomal protein S19 1.6E-25 50 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53733|RT19_YEAST 37S ribosomal protein S19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM19 PE=1 SV=1 1 107 1.0E-27
sp|Q9US30|RT19_SCHPO Probable ribosomal protein S19, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm19 PE=3 SV=2 34 109 7.0E-19
sp|Q8EUB7|RS19_MYCPE 30S ribosomal protein S19 OS=Mycoplasma penetrans (strain HF-2) GN=rpsS PE=3 SV=2 34 110 4.0E-18
sp|B2UMT6|RS19_AKKM8 30S ribosomal protein S19 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpsS PE=3 SV=1 49 105 6.0E-17
sp|B5ZB44|RS19_UREU1 30S ribosomal protein S19 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsS PE=3 SV=1 55 102 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53733|RT19_YEAST 37S ribosomal protein S19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM19 PE=1 SV=1 1 107 1.0E-27
sp|Q9US30|RT19_SCHPO Probable ribosomal protein S19, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm19 PE=3 SV=2 34 109 7.0E-19
sp|Q8EUB7|RS19_MYCPE 30S ribosomal protein S19 OS=Mycoplasma penetrans (strain HF-2) GN=rpsS PE=3 SV=2 34 110 4.0E-18
sp|B2UMT6|RS19_AKKM8 30S ribosomal protein S19 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpsS PE=3 SV=1 49 105 6.0E-17
sp|B5ZB44|RS19_UREU1 30S ribosomal protein S19 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsS PE=3 SV=1 55 102 7.0E-17
sp|Q9PQQ6|RS19_UREPA 30S ribosomal protein S19 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsS PE=3 SV=1 55 102 7.0E-17
sp|B1AIM4|RS19_UREP2 30S ribosomal protein S19 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsS PE=3 SV=1 55 102 7.0E-17
sp|Q98PY5|RS19_MYCPU 30S ribosomal protein S19 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsS PE=3 SV=1 55 102 1.0E-16
sp|Q0BYB8|RS19_HYPNA 30S ribosomal protein S19 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsS PE=3 SV=1 50 105 1.0E-16
sp|Q748Z2|RS19_GEOSL 30S ribosomal protein S19 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsS PE=3 SV=1 55 105 1.0E-16
sp|A7HBM2|RS19_ANADF 30S ribosomal protein S19 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsS PE=3 SV=1 49 105 1.0E-16
sp|B4UBA3|RS19_ANASK 30S ribosomal protein S19 OS=Anaeromyxobacter sp. (strain K) GN=rpsS PE=3 SV=1 49 105 1.0E-16
sp|Q2IJ80|RS19_ANADE 30S ribosomal protein S19 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsS PE=3 SV=1 49 105 1.0E-16
sp|B8J864|RS19_ANAD2 30S ribosomal protein S19 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsS PE=3 SV=1 49 105 1.0E-16
sp|B5YG43|RS19_THEYD 30S ribosomal protein S19 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsS PE=3 SV=1 49 102 2.0E-16
sp|Q4A5C5|RS19_MYCS5 30S ribosomal protein S19 OS=Mycoplasma synoviae (strain 53) GN=rpsS PE=3 SV=1 55 102 3.0E-16
sp|Q8RIF9|RS19_FUSNN 30S ribosomal protein S19 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsS PE=3 SV=1 48 105 5.0E-16
sp|Q1D771|RS19_MYXXD 30S ribosomal protein S19 OS=Myxococcus xanthus (strain DK 1622) GN=rpsS PE=3 SV=1 51 102 7.0E-16
sp|A1VEB2|RS19_DESVV 30S ribosomal protein S19 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsS PE=3 SV=1 54 105 9.0E-16
sp|Q72CH6|RS19_DESVH 30S ribosomal protein S19 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsS PE=3 SV=1 54 105 9.0E-16
sp|Q39Y02|RS19_GEOMG 30S ribosomal protein S19 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsS PE=3 SV=1 55 102 9.0E-16
sp|C0QW00|RS19_BRAHW 30S ribosomal protein S19 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rpsS PE=3 SV=1 48 103 1.0E-15
sp|B3PMP3|RS19_MYCA5 30S ribosomal protein S19 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsS PE=3 SV=1 55 102 1.0E-15
sp|Q3A6P3|RS19_PELCD 30S ribosomal protein S19 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsS PE=3 SV=1 55 105 1.0E-15
sp|A1ALU5|RS19_PELPD 30S ribosomal protein S19 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsS PE=3 SV=1 55 105 1.0E-15
sp|C1A6Q9|RS19_GEMAT 30S ribosomal protein S19 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rpsS PE=3 SV=1 55 102 1.0E-15
sp|B8IYH6|RS19_DESDA 30S ribosomal protein S19 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsS PE=3 SV=1 55 105 2.0E-15
sp|O52336|RS19_MYCGA 30S ribosomal protein S19 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsS PE=3 SV=1 50 102 2.0E-15
sp|Q6KI51|RS19_MYCMO 30S ribosomal protein S19 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsS PE=3 SV=1 55 102 2.0E-15
sp|Q0ANQ4|RS19_MARMM 30S ribosomal protein S19 OS=Maricaulis maris (strain MCS10) GN=rpsS PE=3 SV=1 49 102 2.0E-15
sp|C6E4Q3|RS19_GEOSM 30S ribosomal protein S19 OS=Geobacter sp. (strain M21) GN=rpsS PE=3 SV=1 55 102 2.0E-15
sp|B5EFQ4|RS19_GEOBB 30S ribosomal protein S19 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsS PE=3 SV=1 55 102 2.0E-15
sp|A5GAW9|RS19_GEOUR 30S ribosomal protein S19 OS=Geobacter uraniireducens (strain Rf4) GN=rpsS PE=3 SV=1 55 102 3.0E-15
sp|B9M6H4|RS19_GEODF 30S ribosomal protein S19 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsS PE=3 SV=1 55 102 3.0E-15
sp|P75576|RS19_MYCPN 30S ribosomal protein S19 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsS PE=3 SV=1 50 105 3.0E-15
sp|P47401|RS19_MYCGE 30S ribosomal protein S19 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsS PE=3 SV=1 55 105 3.0E-15
sp|Q01W96|RS19_SOLUE 30S ribosomal protein S19 OS=Solibacter usitatus (strain Ellin6076) GN=rpsS PE=3 SV=1 55 102 4.0E-15
sp|C4XLX7|RS19_DESMR 30S ribosomal protein S19 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsS PE=3 SV=1 55 105 5.0E-15
sp|C0R305|RS19_WOLWR 30S ribosomal protein S19 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rpsS PE=3 SV=1 54 103 5.0E-15
sp|Q73H90|RS19_WOLPM 30S ribosomal protein S19 OS=Wolbachia pipientis wMel GN=rpsS PE=3 SV=1 54 103 5.0E-15
sp|Q6MJ18|RS19_BDEBA 30S ribosomal protein S19 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsS PE=3 SV=1 54 105 5.0E-15
sp|A9ETF4|RS19_SORC5 30S ribosomal protein S19 OS=Sorangium cellulosum (strain So ce56) GN=rpsS PE=3 SV=1 55 105 6.0E-15
sp|Q1MPQ9|RS19_LAWIP 30S ribosomal protein S19 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsS PE=3 SV=1 55 102 6.0E-15
sp|C6C189|RS19_DESAD 30S ribosomal protein S19 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsS PE=3 SV=1 42 102 6.0E-15
sp|A0LIJ4|RS19_SYNFM 30S ribosomal protein S19 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsS PE=3 SV=1 42 102 6.0E-15
sp|A5IYY2|RS19_MYCAP 30S ribosomal protein S19 OS=Mycoplasma agalactiae (strain PG2) GN=rpsS PE=3 SV=1 55 102 7.0E-15
sp|B6YQ81|RS19_AZOPC 30S ribosomal protein S19 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsS PE=3 SV=1 50 103 7.0E-15
sp|B7J247|RS19_BORBZ 30S ribosomal protein S19 OS=Borrelia burgdorferi (strain ZS7) GN=rpsS PE=3 SV=1 43 102 7.0E-15
sp|P94271|RS19_BORBU 30S ribosomal protein S19 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsS PE=3 SV=2 43 102 7.0E-15
sp|Q661D8|RS19_BORBP 30S ribosomal protein S19 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsS PE=3 SV=1 43 102 7.0E-15
sp|Q0SN25|RS19_BORAP 30S ribosomal protein S19 OS=Borrelia afzelii (strain PKo) GN=rpsS PE=3 SV=1 43 102 7.0E-15
sp|Q2N9B5|RS19_ERYLH 30S ribosomal protein S19 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsS PE=3 SV=1 8 102 7.0E-15
sp|Q2G8X6|RS19_NOVAD 30S ribosomal protein S19 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsS PE=3 SV=1 49 102 8.0E-15
sp|A5GVW4|RS19_SYNR3 30S ribosomal protein S19 OS=Synechococcus sp. (strain RCC307) GN=rpsS PE=3 SV=1 49 110 8.0E-15
sp|Q9ZI46|RS19_AQUPY 30S ribosomal protein S19 OS=Aquifex pyrophilus GN=rpsS PE=3 SV=1 48 102 8.0E-15
sp|A5V5Z8|RS19_SPHWW 30S ribosomal protein S19 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsS PE=3 SV=1 49 102 9.0E-15
sp|B1ZNE4|RS19_OPITP 30S ribosomal protein S19 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsS PE=3 SV=1 48 102 9.0E-15
sp|B8DNA0|RS19_DESVM 30S ribosomal protein S19 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsS PE=3 SV=1 54 102 9.0E-15
sp|Q7UN16|RS19_RHOBA 30S ribosomal protein S19 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsS PE=3 SV=1 49 102 9.0E-15
sp|Q11HQ6|RS19_CHESB 30S ribosomal protein S19 OS=Chelativorans sp. (strain BNC1) GN=rpsS PE=3 SV=1 55 105 2.0E-14
sp|B0V6X2|RS19_ACIBY 30S ribosomal protein S19 OS=Acinetobacter baumannii (strain AYE) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B0VQS2|RS19_ACIBS 30S ribosomal protein S19 OS=Acinetobacter baumannii (strain SDF) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B2HZL8|RS19_ACIBC 30S ribosomal protein S19 OS=Acinetobacter baumannii (strain ACICU) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B7IA35|RS19_ACIB5 30S ribosomal protein S19 OS=Acinetobacter baumannii (strain AB0057) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B7GW06|RS19_ACIB3 30S ribosomal protein S19 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|O66435|RS19_AQUAE 30S ribosomal protein S19 OS=Aquifex aeolicus (strain VF5) GN=rpsS PE=3 SV=2 49 102 2.0E-14
sp|Q6F1Z0|RS19_MESFL 30S ribosomal protein S19 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsS PE=3 SV=1 55 103 2.0E-14
sp|Q4FLM2|RS19_PELUB 30S ribosomal protein S19 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsS PE=3 SV=1 8 102 2.0E-14
sp|Q4AAE4|RS19_MYCHJ 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsS PE=3 SV=1 55 105 2.0E-14
sp|Q4A8H5|RS19_MYCH7 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsS PE=3 SV=1 55 105 2.0E-14
sp|Q601L1|RS19_MYCH2 30S ribosomal protein S19 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsS PE=3 SV=1 55 105 2.0E-14
sp|B1HMX6|RS19_LYSSC 30S ribosomal protein S19 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsS PE=3 SV=1 50 102 2.0E-14
sp|Q6F7R6|RS19_ACIAD 30S ribosomal protein S19 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B3E7T9|RS19_GEOLS 30S ribosomal protein S19 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsS PE=3 SV=1 55 105 2.0E-14
sp|Q1LI41|RS19_CUPMC 30S ribosomal protein S19 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsS PE=3 SV=1 40 110 2.0E-14
sp|Q8GM56|RS19_MYCHP 30S ribosomal protein S19 OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=rpsS PE=3 SV=1 55 102 2.0E-14
sp|B9DM27|RS19_STACT 30S ribosomal protein S19 OS=Staphylococcus carnosus (strain TM300) GN=rpsS PE=3 SV=1 50 102 2.0E-14
sp|A6KYJ1|RS19_BACV8 30S ribosomal protein S19 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsS PE=3 SV=1 48 102 2.0E-14
sp|Q4L8B0|RS19_STAHJ 30S ribosomal protein S19 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsS PE=3 SV=1 50 102 2.0E-14
sp|Q8CRG4|RS19_STAES 30S ribosomal protein S19 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsS PE=3 SV=1 50 102 2.0E-14
sp|Q5HM03|RS19_STAEQ 30S ribosomal protein S19 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsS PE=3 SV=1 50 102 2.0E-14
sp|Q5FM86|RS19_LACAC 30S ribosomal protein S19 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsS PE=3 SV=2 31 105 3.0E-14
sp|P66495|RS19_STAAW 30S ribosomal protein S19 OS=Staphylococcus aureus (strain MW2) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q6G775|RS19_STAAS 30S ribosomal protein S19 OS=Staphylococcus aureus (strain MSSA476) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q6GEI7|RS19_STAAR 30S ribosomal protein S19 OS=Staphylococcus aureus (strain MRSA252) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|P66494|RS19_STAAN 30S ribosomal protein S19 OS=Staphylococcus aureus (strain N315) GN=rpsS PE=1 SV=1 50 102 3.0E-14
sp|P66493|RS19_STAAM 30S ribosomal protein S19 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|A6QJ88|RS19_STAAE 30S ribosomal protein S19 OS=Staphylococcus aureus (strain Newman) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q5HDW2|RS19_STAAC 30S ribosomal protein S19 OS=Staphylococcus aureus (strain COL) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q2YYQ0|RS19_STAAB 30S ribosomal protein S19 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|A5IV30|RS19_STAA9 30S ribosomal protein S19 OS=Staphylococcus aureus (strain JH9) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q2FW10|RS19_STAA8 30S ribosomal protein S19 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|Q2FEP3|RS19_STAA3 30S ribosomal protein S19 OS=Staphylococcus aureus (strain USA300) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|A6U3X1|RS19_STAA2 30S ribosomal protein S19 OS=Staphylococcus aureus (strain JH1) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|A7X5F7|RS19_STAA1 30S ribosomal protein S19 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|B2JI62|RS19_BURP8 30S ribosomal protein S19 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsS PE=3 SV=1 55 110 3.0E-14
sp|B5RPI6|RS19_BORRA 30S ribosomal protein S19 OS=Borrelia recurrentis (strain A1) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|A8YXK9|RS19_LACH4 30S ribosomal protein S19 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsS PE=3 SV=1 31 105 3.0E-14
sp|A6W388|RS19_MARMS 30S ribosomal protein S19 OS=Marinomonas sp. (strain MWYL1) GN=rpsS PE=3 SV=1 55 102 3.0E-14
sp|B8FET1|RS19_DESAA 30S ribosomal protein S19 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsS PE=3 SV=1 54 102 3.0E-14
sp|Q3AUW8|RS19_SYNS9 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9902) GN=rpsS PE=3 SV=1 53 110 3.0E-14
sp|A0L5X7|RS19_MAGMM 30S ribosomal protein S19 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsS PE=3 SV=1 49 105 3.0E-14
sp|Q8A480|RS19_BACTN 30S ribosomal protein S19 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsS PE=3 SV=1 48 102 3.0E-14
sp|A1QZR8|RS19_BORT9 30S ribosomal protein S19 OS=Borrelia turicatae (strain 91E135) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|B2S0I5|RS19_BORHD 30S ribosomal protein S19 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpsS PE=3 SV=1 50 102 3.0E-14
sp|B2UEL5|RS19_RALPJ 30S ribosomal protein S19 OS=Ralstonia pickettii (strain 12J) GN=rpsS PE=3 SV=1 55 110 3.0E-14
sp|Q8XV16|RS19_RALSO 30S ribosomal protein S19 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsS PE=3 SV=1 55 110 3.0E-14
sp|A8ZV61|RS19_DESOH 30S ribosomal protein S19 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsS PE=3 SV=1 55 102 4.0E-14
sp|A9BCP3|RS19_PROM4 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsS PE=3 SV=1 40 110 4.0E-14
sp|C0Q9W9|RS19_DESAH 30S ribosomal protein S19 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsS PE=3 SV=1 54 102 4.0E-14
sp|Q7U4J6|RS19_SYNPX 30S ribosomal protein S19 OS=Synechococcus sp. (strain WH8102) GN=rpsS PE=3 SV=1 54 110 4.0E-14
sp|Q0AIJ1|RS19_NITEC 30S ribosomal protein S19 OS=Nitrosomonas eutropha (strain C91) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A0M594|RS19_GRAFK 30S ribosomal protein S19 OS=Gramella forsetii (strain KT0803) GN=rpsS PE=3 SV=1 51 102 4.0E-14
sp|Q13TH4|RS19_BURXL 30S ribosomal protein S19 OS=Burkholderia xenovorans (strain LB400) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A4JAP4|RS19_BURVG 30S ribosomal protein S19 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q2SU31|RS19_BURTA 30S ribosomal protein S19 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q63Q15|RS19_BURPS 30S ribosomal protein S19 OS=Burkholderia pseudomallei (strain K96243) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|B2T747|RS19_BURPP 30S ribosomal protein S19 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A3NEH5|RS19_BURP6 30S ribosomal protein S19 OS=Burkholderia pseudomallei (strain 668) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q3JMR7|RS19_BURP1 30S ribosomal protein S19 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A3P0A9|RS19_BURP0 30S ribosomal protein S19 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A1V899|RS19_BURMS 30S ribosomal protein S19 OS=Burkholderia mallei (strain SAVP1) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q62GK9|RS19_BURMA 30S ribosomal protein S19 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A2S7I0|RS19_BURM9 30S ribosomal protein S19 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A3MRV8|RS19_BURM7 30S ribosomal protein S19 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A9ADJ7|RS19_BURM1 30S ribosomal protein S19 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q39KG3|RS19_BURL3 30S ribosomal protein S19 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q0BJ42|RS19_BURCM 30S ribosomal protein S19 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|B4E5C4|RS19_BURCJ 30S ribosomal protein S19 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|A0K3M9|RS19_BURCH 30S ribosomal protein S19 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|B1JU26|RS19_BURCC 30S ribosomal protein S19 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q1BRV2|RS19_BURCA 30S ribosomal protein S19 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|B1YRD4|RS19_BURA4 30S ribosomal protein S19 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsS PE=3 SV=1 55 110 4.0E-14
sp|Q30Z46|RS19_DESAG 30S ribosomal protein S19 OS=Desulfovibrio alaskensis (strain G20) GN=rpsS PE=3 SV=1 55 102 5.0E-14
sp|A6GZ95|RS19_FLAPJ 30S ribosomal protein S19 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsS PE=3 SV=1 43 102 5.0E-14
sp|Q2S3R0|RS19_SALRD 30S ribosomal protein S19 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsS PE=3 SV=1 54 102 5.0E-14
sp|Q2LQ97|RS19_SYNAS 30S ribosomal protein S19 OS=Syntrophus aciditrophicus (strain SB) GN=rpsS PE=3 SV=1 53 102 5.0E-14
sp|B9KEE4|RS19_CAMLR 30S ribosomal protein S19 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsS PE=3 SV=1 55 102 5.0E-14
sp|B4S5M3|RS19_PROA2 30S ribosomal protein S19 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsS PE=3 SV=1 50 102 5.0E-14
sp|B3E0I8|RS19_METI4 30S ribosomal protein S19 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsS PE=3 SV=1 55 102 6.0E-14
sp|A6T3K0|RS19_JANMA 30S ribosomal protein S19 OS=Janthinobacterium sp. (strain Marseille) GN=rpsS PE=3 SV=1 55 110 6.0E-14
sp|A4G9T4|RS19_HERAR 30S ribosomal protein S19 OS=Herminiimonas arsenicoxydans GN=rpsS PE=3 SV=1 55 110 6.0E-14
sp|A7HWR5|RS19_PARL1 30S ribosomal protein S19 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsS PE=3 SV=1 54 102 6.0E-14
sp|A1KB23|RS19_AZOSB 30S ribosomal protein S19 OS=Azoarcus sp. (strain BH72) GN=rpsS PE=3 SV=1 55 110 6.0E-14
sp|Q64NL2|RS19_BACFR 30S ribosomal protein S19 OS=Bacteroides fragilis (strain YCH46) GN=rpsS PE=3 SV=1 48 102 6.0E-14
sp|Q5L8B3|RS19_BACFN 30S ribosomal protein S19 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsS PE=3 SV=1 48 102 6.0E-14
sp|Q73PM8|RS19_TREDE 30S ribosomal protein S19 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsS PE=3 SV=1 49 102 6.0E-14
sp|Q0K623|RS19_CUPNH 30S ribosomal protein S19 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsS PE=3 SV=1 55 110 7.0E-14
sp|Q6XYY2|RS19_SPIKU 30S ribosomal protein S19 OS=Spiroplasma kunkelii GN=rpsS PE=3 SV=1 51 103 7.0E-14
sp|B3R7R9|RS19_CUPTR 30S ribosomal protein S19 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsS PE=3 SV=1 55 110 7.0E-14
sp|A4SUW5|RS19_POLSQ 30S ribosomal protein S19 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsS PE=3 SV=1 55 110 8.0E-14
sp|B1XSQ5|RS19_POLNS 30S ribosomal protein S19 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsS PE=3 SV=1 55 110 8.0E-14
sp|Q6MSM9|RS19_MYCMS 30S ribosomal protein S19 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsS PE=3 SV=1 55 103 8.0E-14
sp|A5FMZ6|RS19_FLAJ1 30S ribosomal protein S19 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpsS PE=3 SV=1 43 102 8.0E-14
sp|Q3SLP5|RS19_THIDA 30S ribosomal protein S19 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsS PE=3 SV=1 55 110 8.0E-14
sp|B7KHZ1|RS19_CYAP7 30S ribosomal protein S19 OS=Cyanothece sp. (strain PCC 7424) GN=rpsS PE=3 SV=1 49 102 9.0E-14
sp|Q49ZG4|RS19_STAS1 30S ribosomal protein S19 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsS PE=3 SV=1 50 102 9.0E-14
sp|Q9CDW6|RS19_LACLA 30S ribosomal protein S19 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsS PE=3 SV=1 43 102 9.0E-14
sp|P10132|RS19_MYCCT 30S ribosomal protein S19 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsS PE=3 SV=1 54 103 1.0E-13
sp|B0TC60|RS19_HELMI 30S ribosomal protein S19 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|Q7VQE4|RS19_BLOFL 30S ribosomal protein S19 OS=Blochmannia floridanus GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|A5GIU1|RS19_SYNPW 30S ribosomal protein S19 OS=Synechococcus sp. (strain WH7803) GN=rpsS PE=3 SV=1 43 110 1.0E-13
sp|Q1H4N3|RS19_METFK 30S ribosomal protein S19 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsS PE=3 SV=1 55 110 1.0E-13
sp|Q2YAZ3|RS19_NITMU 30S ribosomal protein S19 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|Q46WE8|RS19_CUPPJ 30S ribosomal protein S19 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsS PE=3 SV=1 40 110 1.0E-13
sp|Q7VGE0|RS19_HELHP 30S ribosomal protein S19 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|Q7TUP5|RS19_PROMM 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsS PE=3 SV=1 53 110 1.0E-13
sp|A2CC31|RS19_PROM3 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsS PE=3 SV=1 53 110 1.0E-13
sp|C1DAS1|RS19_LARHH 30S ribosomal protein S19 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsS PE=3 SV=1 55 110 1.0E-13
sp|Q5P328|RS19_AROAE 30S ribosomal protein S19 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsS PE=3 SV=1 50 110 1.0E-13
sp|A8F2E3|RS19_RICM5 30S ribosomal protein S19 OS=Rickettsia massiliae (strain Mtu5) GN=rpsS PE=3 SV=2 51 105 1.0E-13
sp|Q4UMS5|RS19_RICFE 30S ribosomal protein S19 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|Q47J99|RS19_DECAR 30S ribosomal protein S19 OS=Dechloromonas aromatica (strain RCB) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|A8GT65|RS19_RICRS 30S ribosomal protein S19 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|B0BUQ6|RS19_RICRO 30S ribosomal protein S19 OS=Rickettsia rickettsii (strain Iowa) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|C4K2H5|RS19_RICPU 30S ribosomal protein S19 OS=Rickettsia peacockii (strain Rustic) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|Q92GX0|RS19_RICCN 30S ribosomal protein S19 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|C3PPA3|RS19_RICAE 30S ribosomal protein S19 OS=Rickettsia africae (strain ESF-5) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|Q46IR3|RS19_PROMT 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsS PE=3 SV=1 53 110 1.0E-13
sp|A2C4Z5|RS19_PROM1 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsS PE=3 SV=1 53 110 1.0E-13
sp|A6LEI7|RS19_PARD8 30S ribosomal protein S19 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsS PE=3 SV=1 51 102 1.0E-13
sp|Q3YWU3|RS19_SHISS 30S ribosomal protein S19 OS=Shigella sonnei (strain Ss046) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|P0A7U6|RS19_SHIFL 30S ribosomal protein S19 OS=Shigella flexneri GN=rpsS PE=3 SV=2 49 102 1.0E-13
sp|Q32B35|RS19_SHIDS 30S ribosomal protein S19 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|Q31VW0|RS19_SHIBS 30S ribosomal protein S19 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B2U2T4|RS19_SHIB3 30S ribosomal protein S19 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7LRT2|RS19_ESCF3 30S ribosomal protein S19 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|Q1R609|RS19_ECOUT 30S ribosomal protein S19 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B1LHD0|RS19_ECOSM 30S ribosomal protein S19 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B6I230|RS19_ECOSE 30S ribosomal protein S19 OS=Escherichia coli (strain SE11) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7NDT7|RS19_ECOLU 30S ribosomal protein S19 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|P0A7U3|RS19_ECOLI 30S ribosomal protein S19 OS=Escherichia coli (strain K12) GN=rpsS PE=1 SV=2 49 102 1.0E-13
sp|B1IPY3|RS19_ECOLC 30S ribosomal protein S19 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|P0A7U4|RS19_ECOL6 30S ribosomal protein S19 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsS PE=3 SV=2 49 102 1.0E-13
sp|Q0TCE5|RS19_ECOL5 30S ribosomal protein S19 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|A1AGK4|RS19_ECOK1 30S ribosomal protein S19 OS=Escherichia coli O1:K1 / APEC GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|A8A5C1|RS19_ECOHS 30S ribosomal protein S19 OS=Escherichia coli O9:H4 (strain HS) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B1X6G7|RS19_ECODH 30S ribosomal protein S19 OS=Escherichia coli (strain K12 / DH10B) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|C4ZUH1|RS19_ECOBW 30S ribosomal protein S19 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7M1N0|RS19_ECO8A 30S ribosomal protein S19 OS=Escherichia coli O8 (strain IAI1) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7N1A0|RS19_ECO81 30S ribosomal protein S19 OS=Escherichia coli O81 (strain ED1a) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7NLN5|RS19_ECO7I 30S ribosomal protein S19 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B5YTN7|RS19_ECO5E 30S ribosomal protein S19 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|P0A7U5|RS19_ECO57 30S ribosomal protein S19 OS=Escherichia coli O157:H7 GN=rpsS PE=3 SV=2 49 102 1.0E-13
sp|B7L4K5|RS19_ECO55 30S ribosomal protein S19 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7MCT1|RS19_ECO45 30S ribosomal protein S19 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|B7UK40|RS19_ECO27 30S ribosomal protein S19 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|A7ZSK5|RS19_ECO24 30S ribosomal protein S19 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|A8AQL3|RS19_CITK8 30S ribosomal protein S19 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|Q8KAH6|RS19_CHLTE 30S ribosomal protein S19 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|Q82X84|RS19_NITEU 30S ribosomal protein S19 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsS PE=3 SV=1 55 110 1.0E-13
sp|B5RM40|RS19_BORDL 30S ribosomal protein S19 OS=Borrelia duttonii (strain Ly) GN=rpsS PE=3 SV=1 50 102 1.0E-13
sp|A5FZW1|RS19_ACICJ 30S ribosomal protein S19 OS=Acidiphilium cryptum (strain JF-5) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|Q5GSU8|RS19_WOLTR 30S ribosomal protein S19 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsS PE=3 SV=1 55 103 1.0E-13
sp|B1MGE6|RS19_MYCA9 30S ribosomal protein S19 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|A0PM67|RS19_MYCUA 30S ribosomal protein S19 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|B2HSN5|RS19_MYCMM 30S ribosomal protein S19 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|Q5HS94|RS19_CAMJR 30S ribosomal protein S19 OS=Campylobacter jejuni (strain RM1221) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|A1W1V6|RS19_CAMJJ 30S ribosomal protein S19 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|Q9PLX5|RS19_CAMJE 30S ribosomal protein S19 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|A7H652|RS19_CAMJD 30S ribosomal protein S19 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|A8FP17|RS19_CAMJ8 30S ribosomal protein S19 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsS PE=3 SV=1 55 102 1.0E-13
sp|P9WH45|RS19_MYCTU 30S ribosomal protein S19 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsS PE=1 SV=1 54 106 1.0E-13
sp|P9WH44|RS19_MYCTO 30S ribosomal protein S19 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|A5U091|RS19_MYCTA 30S ribosomal protein S19 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|C1AL39|RS19_MYCBT 30S ribosomal protein S19 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|A1KGI6|RS19_MYCBP 30S ribosomal protein S19 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsS PE=3 SV=1 54 106 1.0E-13
sp|P0A5X5|RS19_MYCBO 30S ribosomal protein S19 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsS PE=1 SV=1 54 106 1.0E-13
sp|Q9ZCQ9|RS19_RICPR 30S ribosomal protein S19 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|Q1GPA3|RS19_SPHAL 30S ribosomal protein S19 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsS PE=3 SV=1 49 102 1.0E-13
sp|Q68W82|RS19_RICTY 30S ribosomal protein S19 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsS PE=3 SV=1 51 105 1.0E-13
sp|B3CN30|RS19_WOLPP 30S ribosomal protein S19 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rpsS PE=3 SV=1 54 103 2.0E-13
sp|Q02W28|RS19_LACLS 30S ribosomal protein S19 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsS PE=3 SV=1 43 102 2.0E-13
sp|A2RNQ1|RS19_LACLM 30S ribosomal protein S19 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsS PE=3 SV=1 43 102 2.0E-13
sp|B2KEL7|RS19_ELUMP 30S ribosomal protein S19 OS=Elusimicrobium minutum (strain Pei191) GN=rpsS PE=3 SV=1 50 102 2.0E-13
sp|Q5F5T1|RS19_NEIG1 30S ribosomal protein S19 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsS PE=3 SV=1 55 110 2.0E-13
sp|A1KRH7|RS19_NEIMF 30S ribosomal protein S19 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsS PE=3 SV=1 55 110 2.0E-13
sp|P66487|RS19_NEIMB 30S ribosomal protein S19 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsS PE=3 SV=1 55 110 2.0E-13
sp|P66486|RS19_NEIMA 30S ribosomal protein S19 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsS PE=3 SV=1 55 110 2.0E-13
sp|A9M3W2|RS19_NEIM0 30S ribosomal protein S19 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsS PE=3 SV=1 55 110 2.0E-13
sp|Q5Z1V9|RS19_NOCFA 30S ribosomal protein S19 OS=Nocardia farcinica (strain IFM 10152) GN=rpsS PE=3 SV=1 54 106 2.0E-13
sp|B1LWT0|RS19_METRJ 30S ribosomal protein S19 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|A2SLF3|RS19_METPP 30S ribosomal protein S19 OS=Methylibium petroleiphilum (strain PM1) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|Q7MTL7|RS19_PORGI 30S ribosomal protein S19 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsS PE=3 SV=1 51 102 2.0E-13
sp|B2RLY8|RS19_PORG3 30S ribosomal protein S19 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsS PE=3 SV=1 51 102 2.0E-13
sp|Q3AMN4|RS19_SYNSC 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9605) GN=rpsS PE=3 SV=1 53 110 2.0E-13
sp|Q2W2J5|RS19_MAGSA 30S ribosomal protein S19 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|B2G8X4|RS19_LACRJ 30S ribosomal protein S19 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsS PE=3 SV=1 31 105 2.0E-13
sp|A5VLK1|RS19_LACRD 30S ribosomal protein S19 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsS PE=3 SV=1 31 105 2.0E-13
sp|Q6AP67|RS19_DESPS 30S ribosomal protein S19 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsS PE=3 SV=1 54 102 2.0E-13
sp|B3QR84|RS19_CHLP8 30S ribosomal protein S19 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|Q2L2E7|RS19_BORA1 30S ribosomal protein S19 OS=Bordetella avium (strain 197N) GN=rpsS PE=3 SV=1 43 110 2.0E-13
sp|B3EP57|RS19_CHLPB 30S ribosomal protein S19 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|B2VK60|RS19_ERWT9 30S ribosomal protein S19 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|A4ST02|RS19_AERS4 30S ribosomal protein S19 OS=Aeromonas salmonicida (strain A449) GN=rpsS PE=3 SV=2 49 102 2.0E-13
sp|A0KF25|RS19_AERHH 30S ribosomal protein S19 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q7VTC9|RS19_BORPE 30S ribosomal protein S19 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsS PE=3 SV=1 43 110 2.0E-13
sp|B1JIW5|RS19_YERPY 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|P11256|RS19_YERPS 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsS PE=3 SV=4 49 102 2.0E-13
sp|A4TGZ6|RS19_YERPP 30S ribosomal protein S19 OS=Yersinia pestis (strain Pestoides F) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q1CCU8|RS19_YERPN 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|A9R900|RS19_YERPG 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q8ZJA8|RS19_YERPE 30S ribosomal protein S19 OS=Yersinia pestis GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|B2K5M6|RS19_YERPB 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q1C2V1|RS19_YERPA 30S ribosomal protein S19 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|A7FNN1|RS19_YERP3 30S ribosomal protein S19 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|A1JS33|RS19_YERE8 30S ribosomal protein S19 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q6FZC6|RS19_BARQU 30S ribosomal protein S19 OS=Bartonella quintana (strain Toulouse) GN=rpsS PE=3 SV=1 55 105 2.0E-13
sp|Q6G2W9|RS19_BARHE 30S ribosomal protein S19 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsS PE=3 SV=1 55 105 2.0E-13
sp|Q04C11|RS19_LACDB 30S ribosomal protein S19 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsS PE=3 SV=1 31 102 2.0E-13
sp|Q1GBL4|RS19_LACDA 30S ribosomal protein S19 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsS PE=3 SV=1 31 102 2.0E-13
sp|B4F1I8|RS19_PROMH 30S ribosomal protein S19 OS=Proteus mirabilis (strain HI4320) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q318I8|RS19_PROM9 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsS PE=3 SV=1 53 110 2.0E-13
sp|C6DG70|RS19_PECCP 30S ribosomal protein S19 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|Q6CZX4|RS19_PECAS 30S ribosomal protein S19 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsS PE=3 SV=1 49 102 2.0E-13
sp|B8ELF9|RS19_METSB 30S ribosomal protein S19 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsS PE=3 SV=1 55 105 2.0E-13
sp|B0UHW5|RS19_METS4 30S ribosomal protein S19 OS=Methylobacterium sp. (strain 4-46) GN=rpsS PE=3 SV=1 51 105 2.0E-13
sp|A8ESU7|RS19_ARCB4 30S ribosomal protein S19 OS=Arcobacter butzleri (strain RM4018) GN=rpsS PE=3 SV=1 55 102 2.0E-13
sp|Q0ID09|RS19_SYNS3 30S ribosomal protein S19 OS=Synechococcus sp. (strain CC9311) GN=rpsS PE=3 SV=1 43 110 2.0E-13
sp|A8F4R5|RS19_PSELT 30S ribosomal protein S19 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsS PE=3 SV=1 49 103 3.0E-13
sp|B1ZLK8|RS19_METPB 30S ribosomal protein S19 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A9W4Q5|RS19_METEP 30S ribosomal protein S19 OS=Methylobacterium extorquens (strain PA1) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B7L0R5|RS19_METC4 30S ribosomal protein S19 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B7K331|RS19_CYAP8 30S ribosomal protein S19 OS=Cyanothece sp. (strain PCC 8801) GN=rpsS PE=3 SV=1 55 102 3.0E-13
sp|Q1BDA3|RS19_MYCSS 30S ribosomal protein S19 OS=Mycobacterium sp. (strain MCS) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|A1UBP0|RS19_MYCSK 30S ribosomal protein S19 OS=Mycobacterium sp. (strain KMS) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|A3PVC5|RS19_MYCSJ 30S ribosomal protein S19 OS=Mycobacterium sp. (strain JLS) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|A9IIZ4|RS19_BORPD 30S ribosomal protein S19 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsS PE=3 SV=1 43 110 3.0E-13
sp|C1F638|RS19_ACIC5 30S ribosomal protein S19 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rpsS PE=3 SV=1 55 102 3.0E-13
sp|B5ELY3|RS19_ACIF5 30S ribosomal protein S19 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsS PE=3 SV=1 55 110 3.0E-13
sp|B7J471|RS19_ACIF2 30S ribosomal protein S19 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsS PE=3 SV=1 55 110 3.0E-13
sp|A1T4P3|RS19_MYCVP 30S ribosomal protein S19 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|A0QSD5|RS19_MYCS2 30S ribosomal protein S19 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|Q1RHM5|RS19_RICBR 30S ribosomal protein S19 OS=Rickettsia bellii (strain RML369-C) GN=rpsS PE=3 SV=1 51 105 3.0E-13
sp|A8GVB8|RS19_RICB8 30S ribosomal protein S19 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsS PE=3 SV=1 51 105 3.0E-13
sp|B8I7Y3|RS19_CLOCE 30S ribosomal protein S19 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsS PE=3 SV=1 54 102 3.0E-13
sp|Q493K4|RS19_BLOPB 30S ribosomal protein S19 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|O32985|RS19_MYCLE 30S ribosomal protein S19 OS=Mycobacterium leprae (strain TN) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|B8ZSB5|RS19_MYCLB 30S ribosomal protein S19 OS=Mycobacterium leprae (strain Br4923) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|A4TEC0|RS19_MYCGI 30S ribosomal protein S19 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsS PE=3 SV=1 54 106 3.0E-13
sp|B5ZYT9|RS19_RHILW 30S ribosomal protein S19 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsS PE=3 SV=1 49 105 3.0E-13
sp|Q2K9L2|RS19_RHIEC 30S ribosomal protein S19 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsS PE=3 SV=1 49 105 3.0E-13
sp|B3PWS5|RS19_RHIE6 30S ribosomal protein S19 OS=Rhizobium etli (strain CIAT 652) GN=rpsS PE=3 SV=1 49 105 3.0E-13
sp|P66491|RS19_SALTY 30S ribosomal protein S19 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsS PE=3 SV=2 49 102 3.0E-13
sp|P66492|RS19_SALTI 30S ribosomal protein S19 OS=Salmonella typhi GN=rpsS PE=3 SV=2 49 102 3.0E-13
sp|B4TXD8|RS19_SALSV 30S ribosomal protein S19 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5BGY2|RS19_SALPK 30S ribosomal protein S19 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|C0Q0B2|RS19_SALPC 30S ribosomal protein S19 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A9MSZ4|RS19_SALPB 30S ribosomal protein S19 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|Q5PIV6|RS19_SALPA 30S ribosomal protein S19 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B4SUT6|RS19_SALNS 30S ribosomal protein S19 OS=Salmonella newport (strain SL254) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B4TKL1|RS19_SALHS 30S ribosomal protein S19 OS=Salmonella heidelberg (strain SL476) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5RH19|RS19_SALG2 30S ribosomal protein S19 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5R287|RS19_SALEP 30S ribosomal protein S19 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5FJL0|RS19_SALDC 30S ribosomal protein S19 OS=Salmonella dublin (strain CT_02021853) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|Q57J36|RS19_SALCH 30S ribosomal protein S19 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A9MN52|RS19_SALAR 30S ribosomal protein S19 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5F8E8|RS19_SALA4 30S ribosomal protein S19 OS=Salmonella agona (strain SL483) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A6TEW8|RS19_KLEP7 30S ribosomal protein S19 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B5XN98|RS19_KLEP3 30S ribosomal protein S19 OS=Klebsiella pneumoniae (strain 342) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A4WFC4|RS19_ENT38 30S ribosomal protein S19 OS=Enterobacter sp. (strain 638) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A7MPI3|RS19_CROS8 30S ribosomal protein S19 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|B4SBV1|RS19_PELPB 30S ribosomal protein S19 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsS PE=3 SV=1 49 102 3.0E-13
sp|A7ZG08|RS19_CAMC1 30S ribosomal protein S19 OS=Campylobacter concisus (strain 13826) GN=rpsS PE=3 SV=1 55 102 3.0E-13
sp|Q5FTY7|RS19_GLUOX 30S ribosomal protein S19 OS=Gluconobacter oxydans (strain 621H) GN=rpsS PE=3 SV=1 55 102 3.0E-13
sp|Q03ZP1|RS19_LEUMM 30S ribosomal protein S19 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsS PE=3 SV=1 31 102 3.0E-13
sp|B9JDT2|RS19_AGRRK 30S ribosomal protein S19 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsS PE=3 SV=1 49 105 3.0E-13
sp|Q7V9W6|RS19_PROMA 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsS PE=3 SV=1 54 102 3.0E-13
sp|Q0BUP6|RS19_GRABC 30S ribosomal protein S19 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsS PE=3 SV=1 55 102 4.0E-13
sp|Q73SB0|RS19_MYCPA 30S ribosomal protein S19 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsS PE=3 SV=1 54 106 4.0E-13
sp|A0QL14|RS19_MYCA1 30S ribosomal protein S19 OS=Mycobacterium avium (strain 104) GN=rpsS PE=3 SV=1 54 106 4.0E-13
sp|B0JHZ9|RS19_MICAN 30S ribosomal protein S19 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsS PE=3 SV=1 55 102 4.0E-13
sp|A8EZL2|RS19_RICCK 30S ribosomal protein S19 OS=Rickettsia canadensis (strain McKiel) GN=rpsS PE=3 SV=1 51 102 4.0E-13
sp|Q7W2F2|RS19_BORPA 30S ribosomal protein S19 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsS PE=3 SV=1 43 110 4.0E-13
sp|Q7WRC1|RS19_BORBR 30S ribosomal protein S19 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsS PE=3 SV=1 43 110 4.0E-13
sp|A6QCQ2|RS19_SULNB 30S ribosomal protein S19 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsS PE=3 SV=1 42 102 4.0E-13
sp|Q7NQF6|RS19_CHRVO 30S ribosomal protein S19 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsS PE=3 SV=1 55 102 4.0E-13
sp|Q7MYF5|RS19_PHOLL 30S ribosomal protein S19 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsS PE=3 SV=1 49 102 4.0E-13
sp|B2IK66|RS19_BEII9 30S ribosomal protein S19 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsS PE=3 SV=1 55 105 4.0E-13
sp|Q30TW0|RS19_SULDN 30S ribosomal protein S19 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsS PE=3 SV=1 42 102 4.0E-13
sp|C4KZP2|RS19_EXISA 30S ribosomal protein S19 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsS PE=3 SV=1 49 102 4.0E-13
sp|B1GZ87|RS19_UNCTG 30S ribosomal protein S19 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsS PE=3 SV=1 54 102 4.0E-13
sp|B0T2C6|RS19_CAUSK 30S ribosomal protein S19 OS=Caulobacter sp. (strain K31) GN=rpsS PE=3 SV=1 55 102 4.0E-13
sp|B6IRR0|RS19_RHOCS 30S ribosomal protein S19 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsS PE=3 SV=1 55 102 4.0E-13
sp|B3EUL9|RS19_AMOA5 30S ribosomal protein S19 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsS PE=3 SV=1 54 102 4.0E-13
sp|B8HMQ8|RS19_CYAP4 30S ribosomal protein S19 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsS PE=3 SV=1 49 102 5.0E-13
sp|O24693|RS19_SYNP6 30S ribosomal protein S19 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsS PE=3 SV=1 55 102 5.0E-13
sp|Q31L11|RS19_SYNE7 30S ribosomal protein S19 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsS PE=3 SV=1 55 102 5.0E-13
sp|A8G758|RS19_PROM2 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsS PE=3 SV=1 53 110 5.0E-13
sp|B9E9J5|RS19_MACCJ 30S ribosomal protein S19 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsS PE=3 SV=1 49 102 5.0E-13
sp|Q74L85|RS19_LACJO 30S ribosomal protein S19 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsS PE=3 SV=1 50 102 5.0E-13
sp|Q046C1|RS19_LACGA 30S ribosomal protein S19 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsS PE=3 SV=1 50 102 5.0E-13
sp|A6X0C2|RS19_OCHA4 30S ribosomal protein S19 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsS PE=3 SV=1 8 105 5.0E-13
sp|Q1MID7|RS19_RHIL3 30S ribosomal protein S19 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsS PE=3 SV=1 49 105 5.0E-13
sp|B4R8M1|RS19_PHEZH 30S ribosomal protein S19 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsS PE=3 SV=1 55 102 5.0E-13
sp|A7IFY5|RS19_XANP2 30S ribosomal protein S19 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsS PE=3 SV=1 55 105 5.0E-13
sp|A2BTD3|RS19_PROMS 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain AS9601) GN=rpsS PE=3 SV=1 53 110 5.0E-13
sp|A3PF43|RS19_PROM0 30S ribosomal protein S19 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsS PE=3 SV=1 53 110 5.0E-13
sp|P15761|RR19_CYAPA Cyanelle 30S ribosomal protein S19 OS=Cyanophora paradoxa GN=rps19 PE=3 SV=1 51 102 5.0E-13
sp|P73316|RS19_SYNY3 30S ribosomal protein S19 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsS PE=3 SV=1 49 102 6.0E-13
sp|Q839G0|RS19_ENTFA 30S ribosomal protein S19 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsS PE=3 SV=1 50 102 6.0E-13
sp|A6Q1I2|RS19_NITSB 30S ribosomal protein S19 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsS PE=3 SV=1 42 102 6.0E-13
sp|Q824P7|RS19_CHLCV 30S ribosomal protein S19 OS=Chlamydophila caviae (strain GPIC) GN=rpsS PE=3 SV=1 50 102 6.0E-13
sp|A8Z672|RS19_SULMW 30S ribosomal protein S19 OS=Sulcia muelleri (strain GWSS) GN=rpsS PE=3 SV=1 57 102 6.0E-13
sp|Q252V7|RS19_CHLFF 30S ribosomal protein S19 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsS PE=3 SV=1 50 102 6.0E-13
sp|Q5L716|RS19_CHLAB 30S ribosomal protein S19 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsS PE=3 SV=1 50 102 6.0E-13
sp|Q16AE7|RS19_ROSDO 30S ribosomal protein S19 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsS PE=3 SV=1 55 105 6.0E-13
sp|Q98N53|RS19_RHILO 30S ribosomal protein S19 OS=Rhizobium loti (strain MAFF303099) GN=rpsS PE=3 SV=1 8 105 6.0E-13
sp|Q5QXY1|RS19_IDILO 30S ribosomal protein S19 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsS PE=3 SV=1 49 102 6.0E-13
sp|Q8DMM7|RS19_THEEB 30S ribosomal protein S19 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsS PE=3 SV=1 55 102 7.0E-13
sp|A5VR02|RS19_BRUO2 30S ribosomal protein S19 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsS PE=3 SV=1 49 105 7.0E-13
sp|B1X504|RR19_PAUCH 30S ribosomal protein S19, organellar chromatophore OS=Paulinella chromatophora GN=rps19 PE=3 SV=1 50 110 7.0E-13
sp|A1USL8|RS19_BARBK 30S ribosomal protein S19 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsS1 PE=3 SV=1 55 105 7.0E-13
sp|A9NED7|RS19_ACHLI 30S ribosomal protein S19 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsS PE=3 SV=1 31 102 7.0E-13
sp|Q3IF21|RS19_PSEHT 30S ribosomal protein S19 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsS PE=3 SV=1 49 102 7.0E-13
sp|Q6ME59|RS19_PARUW 30S ribosomal protein S19 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsS PE=3 SV=1 49 102 7.0E-13
sp|B3QY28|RS19_CHLT3 30S ribosomal protein S19 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsS PE=3 SV=1 49 102 7.0E-13
sp|A9H3Q2|RS19_GLUDA 30S ribosomal protein S19 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsS PE=3 SV=1 55 102 7.0E-13
sp|Q3J8R8|RS19_NITOC 30S ribosomal protein S19 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsS PE=3 SV=1 55 110 7.0E-13
sp|Q057A8|RS19_BUCCC 30S ribosomal protein S19 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsS PE=3 SV=1 54 102 7.0E-13
sp|A5D5J4|RS19_PELTS 30S ribosomal protein S19 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsS PE=3 SV=1 49 102 7.0E-13
sp|Q2RQW4|RS19_RHORT 30S ribosomal protein S19 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsS PE=3 SV=1 55 105 7.0E-13
sp|Q9Z7R1|RS19_CHLPN 30S ribosomal protein S19 OS=Chlamydia pneumoniae GN=rpsS PE=3 SV=2 50 102 7.0E-13
sp|B1MW10|RS19_LEUCK 30S ribosomal protein S19 OS=Leuconostoc citreum (strain KM20) GN=rpsS PE=3 SV=1 31 102 7.0E-13
sp|B8G6S1|RS19_CHLAD 30S ribosomal protein S19 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsS PE=3 SV=1 54 102 7.0E-13
sp|C1B016|RS19_RHOOB 30S ribosomal protein S19 OS=Rhodococcus opacus (strain B4) GN=rpsS PE=3 SV=1 54 106 8.0E-13
sp|Q0S3H2|RS19_RHOJR 30S ribosomal protein S19 OS=Rhodococcus jostii (strain RHA1) GN=rpsS PE=3 SV=1 54 106 8.0E-13
sp|C0ZW29|RS19_RHOE4 30S ribosomal protein S19 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsS PE=3 SV=1 54 106 8.0E-13
sp|Q21RW2|RS19_RHOFT 30S ribosomal protein S19 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsS PE=3 SV=1 55 102 8.0E-13
sp|B1Y8I3|RS19_LEPCP 30S ribosomal protein S19 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsS PE=3 SV=1 55 102 8.0E-13
sp|A5EX78|RS19_DICNV 30S ribosomal protein S19 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsS PE=3 SV=1 55 102 8.0E-13
sp|B9JVP1|RS19_AGRVS 30S ribosomal protein S19 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsS PE=3 SV=1 55 105 9.0E-13
sp|B8IS89|RS19_METNO 30S ribosomal protein S19 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsS PE=3 SV=1 55 105 9.0E-13
sp|B3EGY6|RS19_CHLL2 30S ribosomal protein S19 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsS PE=3 SV=1 55 102 9.0E-13
sp|B2GDW5|RS19_LACF3 30S ribosomal protein S19 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsS PE=3 SV=1 31 102 9.0E-13
sp|Q28UV6|RS19_JANSC 30S ribosomal protein S19 OS=Jannaschia sp. (strain CCS1) GN=rpsS PE=3 SV=1 55 105 9.0E-13
sp|Q5WLQ8|RS19_BACSK 30S ribosomal protein S19 OS=Bacillus clausii (strain KSM-K16) GN=rpsS PE=3 SV=1 55 110 9.0E-13
sp|A9IW23|RS19_BART1 30S ribosomal protein S19 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsS PE=3 SV=1 55 105 9.0E-13
sp|A6U863|RS19_SINMW 30S ribosomal protein S19 OS=Sinorhizobium medicae (strain WSM419) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|C3MAY4|RS19_RHISN 30S ribosomal protein S19 OS=Rhizobium sp. (strain NGR234) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|P66488|RS19_RHIME 30S ribosomal protein S19 OS=Rhizobium meliloti (strain 1021) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|P66490|RS19_BRUSU 30S ribosomal protein S19 OS=Brucella suis biovar 1 (strain 1330) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|B0CH28|RS19_BRUSI 30S ribosomal protein S19 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|P66489|RS19_BRUME 30S ribosomal protein S19 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|C0RJJ7|RS19_BRUMB 30S ribosomal protein S19 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|A9M5P6|RS19_BRUC2 30S ribosomal protein S19 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|Q57CR2|RS19_BRUAB 30S ribosomal protein S19 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|Q2YM07|RS19_BRUA2 30S ribosomal protein S19 OS=Brucella abortus (strain 2308) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|B2S675|RS19_BRUA1 30S ribosomal protein S19 OS=Brucella abortus (strain S19) GN=rpsS PE=3 SV=1 49 105 9.0E-13
sp|C0ZII4|RS19_BREBN 30S ribosomal protein S19 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|P26874|RT19_MARPO Ribosomal protein S19, mitochondrial OS=Marchantia polymorpha GN=RPS19 PE=3 SV=2 56 103 1.0E-12
sp|Q4G361|RR19_EMIHU 30S ribosomal protein S19, chloroplastic OS=Emiliania huxleyi GN=rps19 PE=3 SV=1 51 110 1.0E-12
sp|O46898|RR19_GUITH 30S ribosomal protein S19, chloroplastic OS=Guillardia theta GN=rps19 PE=3 SV=1 54 110 1.0E-12
sp|B1XJT5|RS19_SYNP2 30S ribosomal protein S19 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsS PE=3 SV=1 55 102 1.0E-12
sp|B1WQR4|RS19_CYAA5 30S ribosomal protein S19 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsS PE=3 SV=1 55 102 1.0E-12
sp|A8LM58|RS19_DINSH 30S ribosomal protein S19 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsS PE=3 SV=1 55 105 1.0E-12
sp|Q3APH7|RS19_CHLCH 30S ribosomal protein S19 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsS PE=3 SV=1 49 102 1.0E-12
sp|Q6YR17|RS19_ONYPE 30S ribosomal protein S19 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|Q2NIV8|RS19_AYWBP 30S ribosomal protein S19 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|Q50265|RS19_ASTYP 30S ribosomal protein S19 OS=Aster yellows phytoplasma GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|B2FQ49|RS19_STRMK 30S ribosomal protein S19 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsS PE=3 SV=1 48 102 1.0E-12
sp|B0C1D7|RS19_ACAM1 30S ribosomal protein S19 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsS PE=3 SV=1 49 102 1.0E-12
sp|Q81J38|RS19_BACCR 30S ribosomal protein S19 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsS PE=3 SV=1 50 102 1.0E-12
sp|B7HJ52|RS19_BACC4 30S ribosomal protein S19 OS=Bacillus cereus (strain B4264) GN=rpsS PE=3 SV=1 50 102 1.0E-12
sp|B9KZY3|RS19_THERP 30S ribosomal protein S19 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|B5XJ40|RS19_STRPZ 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsS PE=3 SV=1 43 102 1.0E-12
sp|P66480|RS19_CHLTR 30S ribosomal protein S19 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsS PE=3 SV=1 40 102 1.0E-12
sp|B0BCG3|RS19_CHLTB 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsS PE=3 SV=1 40 102 1.0E-12
sp|Q3KLH3|RS19_CHLTA 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsS PE=3 SV=1 40 102 1.0E-12
sp|B0B898|RS19_CHLT2 30S ribosomal protein S19 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsS PE=3 SV=1 40 102 1.0E-12
sp|P66481|RS19_CHLMU 30S ribosomal protein S19 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsS PE=3 SV=1 40 102 1.0E-12
sp|Q2NQM6|RS19_SODGM 30S ribosomal protein S19 OS=Sodalis glossinidius (strain morsitans) GN=rpsS PE=3 SV=1 49 102 1.0E-12
sp|Q1GK30|RS19_RUEST 30S ribosomal protein S19 OS=Ruegeria sp. (strain TM1040) GN=rpsS PE=3 SV=1 55 105 1.0E-12
sp|B0RZU4|RS19_FINM2 30S ribosomal protein S19 OS=Finegoldia magna (strain ATCC 29328) GN=rpsS PE=3 SV=1 55 110 1.0E-12
sp|Q5LW58|RS19_RUEPO 30S ribosomal protein S19 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsS PE=3 SV=1 55 105 1.0E-12
sp|B4SKW7|RS19_STRM5 30S ribosomal protein S19 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsS PE=3 SV=1 48 102 1.0E-12
sp|A1TJ11|RS19_ACIAC 30S ribosomal protein S19 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsS PE=3 SV=1 55 102 1.0E-12
sp|B8D0C8|RS19_HALOH 30S ribosomal protein S19 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsS PE=3 SV=1 51 103 1.0E-12
sp|A4SCR3|RS19_CHLPM 30S ribosomal protein S19 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsS PE=3 SV=1 49 102 1.0E-12
sp|Q07KM2|RS19_RHOP5 30S ribosomal protein S19 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsS PE=3 SV=1 55 105 1.0E-12
sp|Q1R0H1|RS19_CHRSD 30S ribosomal protein S19 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsS PE=3 SV=1 55 102 1.0E-12
sp|C4LL48|RS19_CORK4 30S ribosomal protein S19 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsS PE=3 SV=1 54 102 1.0E-12
sp|A7GK24|RS19_BACCN 30S ribosomal protein S19 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsS PE=3 SV=1 50 102 1.0E-12
sp|A8GPE6|RS19_RICAH 30S ribosomal protein S19 OS=Rickettsia akari (strain Hartford) GN=rpsS PE=3 SV=1 51 102 1.0E-12
sp|A9VP81|RS19_BACWK 30S ribosomal protein S19 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsS PE=3 SV=1 50 102 1.0E-12
sp|Q04G81|RS19_OENOB 30S ribosomal protein S19 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsS PE=3 SV=1 50 102 1.0E-12
sp|Q31IX8|RS19_THICR 30S ribosomal protein S19 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsS PE=3 SV=1 42 102 1.0E-12
sp|B9KL95|RS19_RHOSK 30S ribosomal protein S19 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsS PE=3 SV=1 51 105 1.0E-12
sp|A4WVK4|RS19_RHOS5 30S ribosomal protein S19 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsS PE=3 SV=1 51 105 1.0E-12
sp|Q3J5R8|RS19_RHOS4 30S ribosomal protein S19 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsS PE=3 SV=1 51 105 1.0E-12
sp|A3PGL5|RS19_RHOS1 30S ribosomal protein S19 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsS PE=3 SV=1 51 105 1.0E-12
sp|Q12GW7|RS19_POLSJ 30S ribosomal protein S19 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsS PE=3 SV=1 55 102 2.0E-12
sp|C1CP92|RS19_STRZT 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|C1CIA1|RS19_STRZP 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain P1031) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|C1CC10|RS19_STRZJ 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain JJA) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|A4VSF8|RS19_STRSY 30S ribosomal protein S19 OS=Streptococcus suis (strain 05ZYH33) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|A3CK67|RS19_STRSV 30S ribosomal protein S19 OS=Streptococcus sanguinis (strain SK36) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|A4VYP7|RS19_STRS2 30S ribosomal protein S19 OS=Streptococcus suis (strain 98HAH33) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|P0A4B6|RS19_STRR6 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B2IS44|RS19_STRPS 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|P0A4B5|RS19_STRPN 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B8ZKG1|RS19_STRPJ 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B1I8K2|RS19_STRPI 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|C1CAL6|RS19_STRP7 30S ribosomal protein S19 OS=Streptococcus pneumoniae (strain 70585) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B5E6F9|RS19_STRP4 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q04MN2|RS19_STRP2 30S ribosomal protein S19 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|A8AZM1|RS19_STRGC 30S ribosomal protein S19 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B9DSV4|RS19_STRU0 30S ribosomal protein S19 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q5M2B7|RS19_STRT2 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q5LXR5|RS19_STRT1 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|C0MCB4|RS19_STRS7 30S ribosomal protein S19 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|P0DE83|RS19_STRPQ 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q48VU5|RS19_STRPM 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|A2RC18|RS19_STRPG 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q1J910|RS19_STRPF 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|Q1JJ58|RS19_STRPD 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|Q1JP13|RS19_STRPC 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|Q1JE54|RS19_STRPB 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|P66498|RS19_STRP8 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q5XED1|RS19_STRP6 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|P0DE82|RS19_STRP3 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|P66496|RS19_STRP1 30S ribosomal protein S19 OS=Streptococcus pyogenes serotype M1 GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|B4U504|RS19_STREM 30S ribosomal protein S19 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsS PE=3 SV=2 50 102 2.0E-12
sp|C0M7R3|RS19_STRE4 30S ribosomal protein S19 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|P66500|RS19_STRA5 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|P66499|RS19_STRA3 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|Q3K3W5|RS19_STRA1 30S ribosomal protein S19 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|A1TYK1|RS19_MARHV 30S ribosomal protein S19 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsS PE=3 SV=1 55 102 2.0E-12
sp|B3QBX6|RS19_RHOPT 30S ribosomal protein S19 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsS PE=3 SV=1 55 105 2.0E-12
sp|Q6N4T8|RS19_RHOPA 30S ribosomal protein S19 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsS PE=1 SV=3 55 105 2.0E-12
sp|B9LJD6|RS19_CHLSY 30S ribosomal protein S19 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsS PE=3 SV=1 55 102 2.0E-12
sp|A9WH70|RS19_CHLAA 30S ribosomal protein S19 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsS PE=3 SV=2 55 102 2.0E-12
sp|Q5GWT8|RS19_XANOR 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|B2SQR4|RS19_XANOP 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|Q2NZY9|RS19_XANOM 30S ribosomal protein S19 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|Q8PC45|RS19_XANCP 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|B0RU78|RS19_XANCB 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|Q4URE3|RS19_XANC8 30S ribosomal protein S19 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsS PE=3 SV=1 48 102 2.0E-12
sp|Q03IF5|RS19_STRTD 30S ribosomal protein S19 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsS PE=3 SV=1 50 102 2.0E-12
sp|A0RM15|RS19_CAMFF 30S ribosomal protein S19 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsS PE=3 SV=1 55 102 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3388
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2035
Ophiocordyceps australis map64 (Brazil) OphauB2|337
Ophiocordyceps camponoti-floridani Ophcf2|03803
Ophiocordyceps camponoti-rufipedis Ophun1|2553 (this protein)
Ophiocordyceps kimflemingae Ophio5|5381
Ophiocordyceps subramaniannii Hirsu2|6335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2553
MQPTRLLLKRSIWKGKLRKPPTHSTETNSHPPAGPNLVPLPIVRPKFPGEKVPAVRTQARAATILPNFVGLRFEV
HNGKNYISINITENMVGHKLGEFAPTRKQHIWRKK*
Coding >Ophun1|2553
ATGCAGCCGACGCGACTGCTCCTCAAGCGCTCCATCTGGAAAGGCAAGCTTCGAAAACCCCCCACACACTCAACA
GAAACTAACTCCCATCCTCCTGCAGGCCCCAATCTCGTCCCCCTACCGATCGTGAGACCCAAGTTCCCAGGCGAA
AAAGTACCCGCCGTCCGCACACAGGCCCGCGCTGCCACGATCCTGCCAAACTTTGTCGGCTTGCGGTTCGAGGTC
CACAACGGCAAGAATTACATCTCCATCAACATCACCGAGAATATGGTCGGGCATAAGCTCGGCGAGTTTGCGCCG
ACGCGAAAACAGCACATCTGGCGCAAGAAGTGA
Transcript >Ophun1|2553
ATGCAGCCGACGCGACTGCTCCTCAAGCGCTCCATCTGGAAAGGCAAGCTTCGAAAACCCCCCACACACTCAACA
GAAACTAACTCCCATCCTCCTGCAGGCCCCAATCTCGTCCCCCTACCGATCGTGAGACCCAAGTTCCCAGGCGAA
AAAGTACCCGCCGTCCGCACACAGGCCCGCGCTGCCACGATCCTGCCAAACTTTGTCGGCTTGCGGTTCGAGGTC
CACAACGGCAAGAATTACATCTCCATCAACATCACCGAGAATATGGTCGGGCATAAGCTCGGCGAGTTTGCGCCG
ACGCGAAAACAGCACATCTGGCGCAAGAAGTGA
Gene >Ophun1|2553
ATGCAGCCGACGCGACTGCTCCTCAAGCGCTCCATCTGGAAAGGCAAGCTTCGAAAACCCCCCACACACTCAACA
GAAACTAACTCCCATCCTCCTGCAGGCCCCAATCTCGTCCCGTGAGTGACTCACCCTTTCCCGCCGACTCTACCA
GTCCTGGTCAGTCGACTGATCGCAACCGCCAGCCTACCGATCGTGAGACCCAAGTTCCCAGGCGAAAAAGTACCC
GCCGTCCGCACACAGGCCCGCGCTGCCACGATCCTGCCAAACTTTGTCGGCTTGCGGTTCGAGGTCCACAACGGC
AAGAATTACATCTCCATCAACATCACCGAGAATATGGTCGGGCATAAGCTCGGCGAGTTTGCGCCGTGCGTTGTC
TGCATCGTCTTTACATTTCAGGGCGTTGACGTTGACCTGGCTTCTACAGGACGCGAAAACAGCACATCTGGCGCA
AGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail