Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2546
Gene name
LocationContig_23:4876..7222
Strand+
Gene length (bp)2346
Transcript length (bp)2199
Coding sequence length (bp)2199
Protein length (aa) 733

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04152 Mre11_DNA_bind Mre11 DNA-binding presumed domain 3.6E-55 295 469
PF00149 Metallophos Calcineurin-like phosphoesterase 3.4E-14 10 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C291|MRE11_NEUCR Double-strand break repair protein mus-23 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-23 PE=3 SV=3 5 567 0.0E+00
sp|Q09683|RAD32_SCHPO DNA repair protein rad32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad32 PE=1 SV=1 2 503 2.0E-177
sp|P32829|MRE11_YEAST Double-strand break repair protein MRE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRE11 PE=1 SV=2 6 691 2.0E-160
sp|Q9UVN9|MRE11_COPC7 Double-strand break repair protein MRE11 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MRE11 PE=3 SV=1 8 493 2.0E-133
sp|Q60HE6|MRE11_MACFA Double-strand break repair protein MRE11A OS=Macaca fascicularis GN=MRE11A PE=2 SV=1 4 486 2.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C291|MRE11_NEUCR Double-strand break repair protein mus-23 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-23 PE=3 SV=3 5 567 0.0E+00
sp|Q09683|RAD32_SCHPO DNA repair protein rad32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad32 PE=1 SV=1 2 503 2.0E-177
sp|P32829|MRE11_YEAST Double-strand break repair protein MRE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRE11 PE=1 SV=2 6 691 2.0E-160
sp|Q9UVN9|MRE11_COPC7 Double-strand break repair protein MRE11 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MRE11 PE=3 SV=1 8 493 2.0E-133
sp|Q60HE6|MRE11_MACFA Double-strand break repair protein MRE11A OS=Macaca fascicularis GN=MRE11A PE=2 SV=1 4 486 2.0E-129
sp|P49959|MRE11_HUMAN Double-strand break repair protein MRE11A OS=Homo sapiens GN=MRE11A PE=1 SV=3 4 486 1.0E-128
sp|Q61216|MRE11_MOUSE Double-strand break repair protein MRE11A OS=Mus musculus GN=Mre11a PE=1 SV=1 4 685 4.0E-128
sp|Q9W6K1|MRE11_XENLA Double-strand break repair protein MRE11 OS=Xenopus laevis GN=mre11 PE=2 SV=1 4 486 5.0E-128
sp|Q9JIM0|MRE11_RAT Double-strand break repair protein MRE11A OS=Rattus norvegicus GN=Mre11a PE=1 SV=1 4 486 4.0E-127
sp|Q9XGM2|MRE11_ARATH Double-strand break repair protein MRE11 OS=Arabidopsis thaliana GN=MRE11 PE=1 SV=1 1 486 2.0E-124
sp|Q7XQR9|MRE11_ORYSJ Double-strand break repair protein MRE11 OS=Oryza sativa subsp. japonica GN=MRE11 PE=1 SV=2 6 590 5.0E-122
sp|Q25AA3|MRE11_ORYSI Double-strand break repair protein MRE11 OS=Oryza sativa subsp. indica GN=H0410G08.11 PE=3 SV=1 6 590 5.0E-122
sp|Q9IAM7|MRE11_CHICK Double-strand break repair protein MRE11 OS=Gallus gallus GN=MRE11 PE=2 SV=1 8 486 2.0E-120
sp|Q23255|MRE11_CAEEL Double-strand break repair protein mre-11 OS=Caenorhabditis elegans GN=mre-11 PE=1 SV=2 8 471 1.0E-96
sp|Q8SRV0|MRE11_ENCCU Double-strand break repair protein MRE11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRE11 PE=3 SV=1 10 508 6.0E-69
[Show less]

GO

GO Term Description Terminal node
GO:0004519 endonuclease activity Yes
GO:0016787 hydrolase activity Yes
GO:0006302 double-strand break repair Yes
GO:0005634 nucleus Yes
GO:0030145 manganese ion binding Yes
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0043227 membrane-bounded organelle No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0043231 intracellular membrane-bounded organelle No
GO:0004518 nuclease activity No
GO:0071704 organic substance metabolic process No
GO:0043169 cation binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0006281 DNA repair No
GO:0110165 cellular anatomical entity No
GO:0043167 ion binding No
GO:0043226 organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2546
MSELTEADTIRILVATDNHVGFEERDAIRKDDSWRTFDEIMNIARTEDACFSPVDMVLLAGDLFHDNKPSRKSLY
QVMRALRKNCLGMKPCPLEFLSDAAEVFEGAFTHVNYEDPDINISIPVFSIHGNHDDPSGDGNLCSLDLLQASGL
LNYFGRVAEADNIEAKPILLQKGLTKLALFGLSNVRDERMFRTFRDHKVKWFRPNVQMGDWFNLLAVHQNHHAHT
ATSYLPENVLPDWLDLVVWGHEHECLIDPTKNPETGFHVMQPGSSVATSLVPGEAVQKHVAIVSVTGKDFRVDKI
PLQTVRPFVTRELVLSQDNRFKGLDKKKDNRQEVTRRLMEVVEEMIEEANADWEAIQTSDTALEERPLPLIRLKV
EYGAQEGCQFECENPQRFSNRFVGKVANTNDVVYFHRKKTSIKKATAVTPAETLEALAEGSDVVKVESLVRDFLS
AQSLKVLPQGPFGEAVNQFVAKDDKHAMELFVSEHLTGQVKQLLGLESDDEDLNGAMEIYRTRIEQQVANGAARQ
QGGRKRILRPKPDTWDSDFDGNWEDEPDAWTFEDATLNVDSRSKTQLKGKSSTVKSRKGTGGRMPDAGEDDGPVP
RAGTKARAARSTTTPKTTTRKTASTRGRGQQVVDENHDGADEDIIMESDGDPPPPKAETKTRRAQATRATTSKRA
TTTTTTTRGAAKGRQTKLNFSQKGATQDQALEVSDDDISDDDDAFEPAPVATRTRRR*
Coding >Ophun1|2546
ATGAGCGAACTTACAGAGGCGGATACGATCCGAATCTTGGTTGCAACCGACAACCACGTCGGCTTCGAGGAGCGC
GACGCCATCCGAAAAGATGACAGCTGGCGCACATTTGACGAGATCATGAACATTGCGAGAACAGAAGACGCATGT
TTCTCTCCTGTTGACATGGTCCTGCTCGCTGGCGATCTTTTCCACGACAACAAACCCTCTCGCAAGTCGCTATAC
CAAGTCATGCGGGCCTTGCGCAAGAACTGTCTCGGGATGAAGCCATGTCCCCTCGAGTTTCTCTCCGACGCCGCA
GAGGTCTTTGAAGGAGCCTTCACCCATGTCAACTACGAAGACCCTGACATCAATATCTCGATCCCCGTCTTCTCC
ATTCACGGAAATCACGACGACCCCTCCGGCGACGGTAACCTGTGCTCCCTGGATCTGCTGCAGGCTAGCGGGCTT
CTCAACTACTTTGGCCGCGTGGCTGAAGCTGACAACATCGAGGCCAAGCCCATCCTGCTTCAGAAGGGCCTCACG
AAATTGGCTCTGTTTGGGCTCAGCAACGTCCGCGACGAACGCATGTTTCGCACCTTTAGGGACCACAAAGTCAAA
TGGTTCCGTCCAAATGTACAGATGGGCGACTGGTTCAACCTGCTGGCCGTACATCAGAACCACCACGCCCATACC
GCCACATCTTACTTACCCGAAAACGTGCTTCCCGACTGGCTGGATCTCGTTGTGTGGGGGCATGAACACGAATGT
CTCATCGATCCCACGAAAAATCCCGAGACTGGTTTCCATGTCATGCAGCCCGGCTCGTCCGTTGCCACCTCACTG
GTGCCTGGGGAGGCTGTTCAGAAACACGTGGCCATTGTCAGCGTCACTGGAAAGGACTTTCGAGTCGACAAGATC
CCGCTGCAGACTGTGCGGCCATTTGTCACCCGTGAGCTTGTTCTGTCCCAGGACAACAGGTTCAAGGGCCTGGAC
AAGAAGAAGGACAACAGGCAGGAGGTGACACGACGATTGATGGAGGTCGTTGAAGAGATGATTGAGGAAGCAAAT
GCCGACTGGGAAGCAATCCAGACGAGCGACACTGCACTCGAAGAGCGTCCTCTGCCACTCATCCGCCTCAAGGTG
GAATACGGCGCTCAAGAAGGGTGCCAGTTCGAATGCGAAAACCCTCAGCGCTTCTCGAACAGATTTGTCGGCAAG
GTGGCCAATACAAATGACGTGGTCTATTTTCACCGGAAGAAGACCTCCATCAAGAAAGCCACGGCCGTCACACCG
GCAGAAACGCTGGAAGCCCTCGCCGAAGGCAGCGACGTTGTCAAGGTTGAATCGCTTGTCCGGGACTTTTTGTCG
GCCCAGTCCCTCAAGGTGCTGCCGCAAGGCCCCTTCGGCGAAGCTGTCAACCAGTTTGTCGCCAAAGATGACAAG
CACGCCATGGAGCTATTCGTCTCAGAGCACCTTACGGGCCAGGTGAAGCAGCTGCTGGGTCTCGAGTCGGACGAT
GAAGACCTCAACGGTGCTATGGAAATTTACCGCACGAGAATAGAACAGCAGGTGGCGAATGGGGCAGCGAGACAG
CAAGGGGGAAGAAAGCGCATTCTGAGGCCCAAACCCGATACTTGGGATAGTGATTTTGACGGGAACTGGGAGGAT
GAGCCCGATGCTTGGACATTTGAGGACGCGACTCTCAACGTTGACTCCAGATCAAAGACACAACTCAAGGGGAAA
TCATCGACAGTGAAATCCCGCAAGGGCACTGGTGGCAGGATGCCAGACGCAGGAGAAGACGACGGACCAGTTCCA
AGGGCTGGGACGAAGGCAAGGGCAGCAAGGTCGACTACGACACCAAAGACAACCACGAGAAAGACGGCATCTACT
CGGGGTCGTGGACAGCAAGTTGTCGACGAAAACCATGACGGGGCCGATGAGGATATCATCATGGAGTCAGACGGG
GATCCGCCGCCGCCAAAAGCCGAAACCAAGACGCGGCGGGCTCAAGCTACCAGAGCAACCACTTCAAAACGAGCG
ACGACGACGACGACGACGACGAGAGGCGCAGCAAAGGGGCGGCAGACTAAACTCAACTTTTCGCAAAAAGGAGCG
ACGCAGGACCAGGCGCTGGAAGTCAGCGACGACGACATCTCGGACGATGACGACGCGTTTGAGCCGGCGCCAGTG
GCAACGAGAACGAGGAGACGGTGA
Transcript >Ophun1|2546
ATGAGCGAACTTACAGAGGCGGATACGATCCGAATCTTGGTTGCAACCGACAACCACGTCGGCTTCGAGGAGCGC
GACGCCATCCGAAAAGATGACAGCTGGCGCACATTTGACGAGATCATGAACATTGCGAGAACAGAAGACGCATGT
TTCTCTCCTGTTGACATGGTCCTGCTCGCTGGCGATCTTTTCCACGACAACAAACCCTCTCGCAAGTCGCTATAC
CAAGTCATGCGGGCCTTGCGCAAGAACTGTCTCGGGATGAAGCCATGTCCCCTCGAGTTTCTCTCCGACGCCGCA
GAGGTCTTTGAAGGAGCCTTCACCCATGTCAACTACGAAGACCCTGACATCAATATCTCGATCCCCGTCTTCTCC
ATTCACGGAAATCACGACGACCCCTCCGGCGACGGTAACCTGTGCTCCCTGGATCTGCTGCAGGCTAGCGGGCTT
CTCAACTACTTTGGCCGCGTGGCTGAAGCTGACAACATCGAGGCCAAGCCCATCCTGCTTCAGAAGGGCCTCACG
AAATTGGCTCTGTTTGGGCTCAGCAACGTCCGCGACGAACGCATGTTTCGCACCTTTAGGGACCACAAAGTCAAA
TGGTTCCGTCCAAATGTACAGATGGGCGACTGGTTCAACCTGCTGGCCGTACATCAGAACCACCACGCCCATACC
GCCACATCTTACTTACCCGAAAACGTGCTTCCCGACTGGCTGGATCTCGTTGTGTGGGGGCATGAACACGAATGT
CTCATCGATCCCACGAAAAATCCCGAGACTGGTTTCCATGTCATGCAGCCCGGCTCGTCCGTTGCCACCTCACTG
GTGCCTGGGGAGGCTGTTCAGAAACACGTGGCCATTGTCAGCGTCACTGGAAAGGACTTTCGAGTCGACAAGATC
CCGCTGCAGACTGTGCGGCCATTTGTCACCCGTGAGCTTGTTCTGTCCCAGGACAACAGGTTCAAGGGCCTGGAC
AAGAAGAAGGACAACAGGCAGGAGGTGACACGACGATTGATGGAGGTCGTTGAAGAGATGATTGAGGAAGCAAAT
GCCGACTGGGAAGCAATCCAGACGAGCGACACTGCACTCGAAGAGCGTCCTCTGCCACTCATCCGCCTCAAGGTG
GAATACGGCGCTCAAGAAGGGTGCCAGTTCGAATGCGAAAACCCTCAGCGCTTCTCGAACAGATTTGTCGGCAAG
GTGGCCAATACAAATGACGTGGTCTATTTTCACCGGAAGAAGACCTCCATCAAGAAAGCCACGGCCGTCACACCG
GCAGAAACGCTGGAAGCCCTCGCCGAAGGCAGCGACGTTGTCAAGGTTGAATCGCTTGTCCGGGACTTTTTGTCG
GCCCAGTCCCTCAAGGTGCTGCCGCAAGGCCCCTTCGGCGAAGCTGTCAACCAGTTTGTCGCCAAAGATGACAAG
CACGCCATGGAGCTATTCGTCTCAGAGCACCTTACGGGCCAGGTGAAGCAGCTGCTGGGTCTCGAGTCGGACGAT
GAAGACCTCAACGGTGCTATGGAAATTTACCGCACGAGAATAGAACAGCAGGTGGCGAATGGGGCAGCGAGACAG
CAAGGGGGAAGAAAGCGCATTCTGAGGCCCAAACCCGATACTTGGGATAGTGATTTTGACGGGAACTGGGAGGAT
GAGCCCGATGCTTGGACATTTGAGGACGCGACTCTCAACGTTGACTCCAGATCAAAGACACAACTCAAGGGGAAA
TCATCGACAGTGAAATCCCGCAAGGGCACTGGTGGCAGGATGCCAGACGCAGGAGAAGACGACGGACCAGTTCCA
AGGGCTGGGACGAAGGCAAGGGCAGCAAGGTCGACTACGACACCAAAGACAACCACGAGAAAGACGGCATCTACT
CGGGGTCGTGGACAGCAAGTTGTCGACGAAAACCATGACGGGGCCGATGAGGATATCATCATGGAGTCAGACGGG
GATCCGCCGCCGCCAAAAGCCGAAACCAAGACGCGGCGGGCTCAAGCTACCAGAGCAACCACTTCAAAACGAGCG
ACGACGACGACGACGACGACGAGAGGCGCAGCAAAGGGGCGGCAGACTAAACTCAACTTTTCGCAAAAAGGAGCG
ACGCAGGACCAGGCGCTGGAAGTCAGCGACGACGACATCTCGGACGATGACGACGCGTTTGAGCCGGCGCCAGTG
GCAACGAGAACGAGGAGACGGTGA
Gene >Ophun1|2546
ATGAGCGAACTTACAGGTAGGACCAAGTAATCGCAAACTCTTGCTACTACACGCTCTAAGATACACTATTTCCAG
AGGCGGATACGATCCGAATCTTGGTTGCAACCGACAACCACGTCGGCTTCGAGGAGCGCGACGCCATCCGAAAAG
ATGACAGCTGGCGCACATTTGACGAGATCATGAACATTGCGAGAACAGAAGACGCATGTTTCTCTCCTGTTTCCA
TACGCTTCTCTCGGCTAACAGACGTCGATTAGGTTGACATGGTCCTGCTCGCTGGCGATCTTTTCCACGACAACA
AACCCTCTCGCAAGTCGCTATACCAAGTCATGCGGGCCTTGCGCAAGAACTGTCTCGGGATGAAGCCATGTCCCC
TCGAGTTTCTCTCCGACGCCGCAGAGGTCTTTGAAGGAGCCTTCACCCATGTCAACTACGAAGACCCTGACATCA
ATATCTCGATCCCCGTCTTCTCCATTCACGGAAATCACGACGACCCCTCCGGCGACGGTAACCTGTGCTCCCTGG
ATCTGCTGCAGGCTAGCGGGCTTCTCAACTACTTTGGCCGCGTGGCTGAAGCTGACAACATCGAGGCCAAGCCCA
TCCTGCTTCAGAAGGGCCTCACGAAATTGGCTCTGTTTGGGCTCAGCAACGTCCGCGACGAACGCATGTTTCGCA
CCTTTAGGGACCACAAAGTCAAATGGTTCCGTCCAAATGTACAGATGGGCGACTGGTTCAACCTGCTGGCCGTAC
ATCAGAACCACCACGCCCATACCGCCACATCTTACTTACCCGAAAACGTGCTTCCCGACTGGCTGGATCTCGTTG
TGTGGGGGCATGAACACGAATGTCTCATCGATCCCACGAAAAATCCCGAGACTGGTTTCCATGTCATGCAGCCCG
GCTCGTCCGTTGCCACCTCACTGGTGCCTGGGGAGGCTGTTCAGAAACACGTGGCCATTGTCAGCGTCACTGGAA
AGGACTTTCGAGTCGACAAGATCCCGCTGCAGACTGTGCGGCCATTTGTCACCCGTGAGCTTGTTCTGTCCCAGG
ACAACAGGTTCAAGGGCCTGGACAAGAAGAAGGACAACAGGCAGGAGGTGACACGACGATTGATGGAGGTCGTTG
AAGAGATGATTGAGGAAGCAAATGCCGACTGGGAAGCAATCCAGACGAGCGACACTGCACTCGAAGAGCGTCCTC
TGCCACTCATCCGCCTCAAGGTGGAATACGGCGCTCAAGAAGGGTGCCAGTTCGAATGCGAAAACCCTCAGCGCT
TCTCGAACAGATTTGTCGGCAAGGTGGCCAATACAAATGACGTGGTCTATTTTCACCGGAAGAAGACCTCCATCA
GTAAGTGCGGCTTACTCTTCTCCATCCTTGATGCTGATATCCGCTCAAGAGAAAGCCACGGCCGTCACACCGGCA
GAAACGCTGGAAGCCCTCGCCGAAGGCAGCGACGTTGTCAAGGTTGAATCGCTTGTCCGGGACTTTTTGTCGGCC
CAGTCCCTCAAGGTGCTGCCGCAAGGCCCCTTCGGCGAAGCTGTCAACCAGTTTGTCGCCAAAGATGACAAGCAC
GCCATGGAGCTATTCGTCTCAGAGCACCTTACGGGCCAGGTGAAGCAGCTGCTGGGTCTCGAGTCGGACGATGAA
GACCTCAACGGTGCTATGGAAATTTACCGCACGAGAATAGAACAGCAGGTGGCGAATGGGGCAGCGAGACAGCAA
GGGGGAAGAAAGCGCATTCTGAGGCCCAAACCCGATACTTGGGATAGTGATTTTGACGGGAACTGGGAGGATGAG
CCCGATGCTTGGACATTTGAGGACGCGACTCTCAACGTTGACTCCAGATCAAAGACACAACTCAAGGGGAAATCA
TCGACAGTGAAATCCCGCAAGGGCACTGGTGGCAGGATGCCAGACGCAGGAGAAGACGACGGACCAGTTCCAAGG
GCTGGGACGAAGGCAAGGGCAGCAAGGTCGACTACGACACCAAAGACAACCACGAGAAAGACGGCATCTACTCGG
GGTCGTGGACAGCAAGTTGTCGACGAAAACCATGACGGGGCCGATGAGGATATCATCATGGAGTCAGACGGGGAT
CCGCCGCCGCCAAAAGCCGAAACCAAGACGCGGCGGGCTCAAGCTACCAGAGCAACCACTTCAAAACGAGCGACG
ACGACGACGACGACGACGAGAGGCGCAGCAAAGGGGCGGCAGACTAAACTCAACTTTTCGCAAAAAGGAGCGACG
CAGGACCAGGCGCTGGAAGTCAGCGACGACGACATCTCGGACGATGACGACGCGTTTGAGCCGGCGCCAGTGGCA
ACGAGAACGAGGAGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail