Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2537
Gene name
LocationContig_229:4155..5264
Strand-
Gene length (bp)1109
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09229 Aha1_N Activator of Hsp90 ATPase, N-terminal 1.1E-42 13 144
PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein 4.8E-19 201 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P782|YNY8_SCHPO Uncharacterized protein C1711.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.08 PE=2 SV=1 5 320 2.0E-90
sp|Q12449|AHA1_YEAST Hsp90 co-chaperone AHA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHA1 PE=1 SV=1 1 320 2.0E-68
sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens GN=AHSA1 PE=1 SV=1 5 320 4.0E-45
sp|Q8BK64|AHSA1_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Mus musculus GN=Ahsa1 PE=1 SV=2 5 320 5.0E-44
sp|Q8N9S3|AHSA2_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Mus musculus GN=Ahsa2 PE=1 SV=2 5 316 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P782|YNY8_SCHPO Uncharacterized protein C1711.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.08 PE=2 SV=1 5 320 2.0E-90
sp|Q12449|AHA1_YEAST Hsp90 co-chaperone AHA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHA1 PE=1 SV=1 1 320 2.0E-68
sp|O95433|AHSA1_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens GN=AHSA1 PE=1 SV=1 5 320 4.0E-45
sp|Q8BK64|AHSA1_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Mus musculus GN=Ahsa1 PE=1 SV=2 5 320 5.0E-44
sp|Q8N9S3|AHSA2_MOUSE Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Mus musculus GN=Ahsa2 PE=1 SV=2 5 316 4.0E-33
sp|P53834|HCH1_YEAST Hsp90 co-chaperone HCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCH1 PE=1 SV=1 1 149 2.0E-21
sp|Q55DB6|AHSA_DICDI Activator of 90 kDa heat shock protein ATPase homolog OS=Dictyostelium discoideum GN=ahsa PE=2 SV=1 4 319 2.0E-18
sp|A6QQC0|AHSA2_BOVIN Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Bos taurus GN=AHSA2 PE=2 SV=1 5 239 1.0E-14
sp|Q719I0|AHSA2_HUMAN Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Homo sapiens GN=AHSA2 PE=1 SV=2 5 277 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0051087 chaperone binding Yes
GO:0001671 ATPase activator activity Yes
GO:0098772 molecular function regulator activity No
GO:0140677 molecular function activator activity No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4337
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|546
Ophiocordyceps australis map64 (Brazil) OphauB2|890
Ophiocordyceps camponoti-floridani Ophcf2|01483
Ophiocordyceps camponoti-rufipedis Ophun1|2537 (this protein)
Ophiocordyceps kimflemingae Ophio5|3857
Ophiocordyceps subramaniannii Hirsu2|8912

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2537
MVLHNPNNWHWVNKDVSQWTRQWLEQNLTKLNVSDGDVEARITGVQSMDGDVDVSQRKGKVITIFDVKLVLDYSG
SAPDAEDVSGTVTVPEIAHDTDEDEYVFEVDIIAESKEKQPVKQLVRSKLVPLLRKEFQKLAPALIDEHGKDIQH
TAGSNPSSGFSTPKLHPETPSAKPSKPNETSTSSGGIVNTVTVTDNEEFRTTAEEMYQTFVDPSRLAAFTRSPPK
LFEGAKKGGKFELFGGNVSGEYLELDAPKKLVQSWRLSQWPAGHYSKLQIEFDQNDVDHVTVMRVTWQGVPVGQE
EVTKRNWVEYYVKSIKQTFG*
Coding >Ophun1|2537
ATGGTGCTGCACAACCCAAACAACTGGCATTGGGTAAACAAGGATGTGTCCCAATGGACCAGGCAATGGCTCGAG
CAGAACCTGACAAAGCTCAACGTGAGCGATGGTGACGTCGAGGCTCGCATAACCGGCGTCCAGAGCATGGATGGG
GATGTCGATGTCAGTCAACGGAAAGGCAAAGTAATCACCATCTTCGACGTCAAACTGGTCCTGGACTATTCGGGC
TCGGCTCCCGACGCTGAGGACGTATCCGGAACCGTCACCGTTCCCGAAATAGCTCACGACACCGACGAAGACGAG
TATGTGTTCGAAGTCGACATCATCGCCGAGTCCAAGGAGAAGCAGCCAGTCAAGCAGCTCGTGCGGTCAAAATTG
GTCCCACTGCTGCGTAAAGAGTTCCAGAAACTCGCTCCCGCGCTGATTGACGAGCACGGCAAGGACATACAGCAT
ACTGCCGGTTCCAACCCATCCAGCGGCTTCTCCACCCCAAAGCTCCATCCCGAGACTCCGTCAGCCAAGCCGTCG
AAACCCAACGAGACGTCGACTAGCTCCGGCGGTATCGTCAACACCGTCACCGTCACCGACAATGAGGAGTTCCGC
ACGACAGCCGAGGAAATGTACCAGACCTTTGTCGATCCATCACGACTAGCCGCATTCACTCGCTCTCCGCCGAAG
CTATTCGAGGGCGCCAAGAAGGGCGGCAAGTTTGAGCTCTTTGGCGGCAACGTGTCCGGCGAGTACCTCGAGCTC
GACGCGCCCAAGAAGCTGGTTCAAAGTTGGCGCTTGAGCCAGTGGCCCGCCGGCCACTACTCCAAGCTTCAGATC
GAGTTTGATCAAAACGACGTTGATCACGTCACTGTCATGCGCGTCACTTGGCAAGGCGTCCCCGTTGGTCAGGAG
GAGGTGACGAAGCGCAACTGGGTCGAGTACTACGTCAAGAGCATCAAGCAAACCTTTGGGTGA
Transcript >Ophun1|2537
ATGGTGCTGCACAACCCAAACAACTGGCATTGGGTAAACAAGGATGTGTCCCAATGGACCAGGCAATGGCTCGAG
CAGAACCTGACAAAGCTCAACGTGAGCGATGGTGACGTCGAGGCTCGCATAACCGGCGTCCAGAGCATGGATGGG
GATGTCGATGTCAGTCAACGGAAAGGCAAAGTAATCACCATCTTCGACGTCAAACTGGTCCTGGACTATTCGGGC
TCGGCTCCCGACGCTGAGGACGTATCCGGAACCGTCACCGTTCCCGAAATAGCTCACGACACCGACGAAGACGAG
TATGTGTTCGAAGTCGACATCATCGCCGAGTCCAAGGAGAAGCAGCCAGTCAAGCAGCTCGTGCGGTCAAAATTG
GTCCCACTGCTGCGTAAAGAGTTCCAGAAACTCGCTCCCGCGCTGATTGACGAGCACGGCAAGGACATACAGCAT
ACTGCCGGTTCCAACCCATCCAGCGGCTTCTCCACCCCAAAGCTCCATCCCGAGACTCCGTCAGCCAAGCCGTCG
AAACCCAACGAGACGTCGACTAGCTCCGGCGGTATCGTCAACACCGTCACCGTCACCGACAATGAGGAGTTCCGC
ACGACAGCCGAGGAAATGTACCAGACCTTTGTCGATCCATCACGACTAGCCGCATTCACTCGCTCTCCGCCGAAG
CTATTCGAGGGCGCCAAGAAGGGCGGCAAGTTTGAGCTCTTTGGCGGCAACGTGTCCGGCGAGTACCTCGAGCTC
GACGCGCCCAAGAAGCTGGTTCAAAGTTGGCGCTTGAGCCAGTGGCCCGCCGGCCACTACTCCAAGCTTCAGATC
GAGTTTGATCAAAACGACGTTGATCACGTCACTGTCATGCGCGTCACTTGGCAAGGCGTCCCCGTTGGTCAGGAG
GAGGTGACGAAGCGCAACTGGGTCGAGTACTACGTCAAGAGCATCAAGCAAACCTTTGGGTGA
Gene >Ophun1|2537
ATGGTGCTGCACAACCCAAACAACTGGCATTGGGTAAACAAGGATGTGTCCCAATGGACCAGGCAATGGCTCGAG
CAGAACCTGACAAAGCTCAACGTGAGCGATGGTGACGTCGAGGCTCGCATAACCGGCGTCCAGAGCATGGATGGG
GATGTCGATGTCAGTCAACGGAAAGGCAAAGTAATCACCATCTTCGACGTCAAACTGGTCCTGGACTATTCGGGT
GAGCACGCGACCGTACTCACGCACGACTCTTCATGCTAACTAAAGGCGCAGGCTCGGCTCCCGACGCTGAGGACG
TATCCGGAACCGTCACCGTTCCCGAAATAGCTCACGACACCGACGAAGACGAGTATGTGGTACGTCTACAGCACC
CATTTCAGTCTCGACCCGCCTAAGTGATCTATCCCGCCTTGTGCTGCTCAAGTCTGCGGCTGACACGACGTCTCC
AGTTCGAAGTCGACATCATCGCCGAGTCCAAGGAGAAGCAGCCAGTCAAGCAGCTCGTGCGGTCAAAATTGGTCC
CACTGCTGCGTAAAGAGTTCCAGAAACTCGCTCCCGCGCTGATTGACGAGCACGGCAAGGACATACAGCATACTG
CCGGTTCCAACCCATCCAGCGGCTTCTCCACCCCAAAGCTCCATCCCGAGACTCCGTCAGCCAAGCCGTCGAAAC
CCAACGAGACGTCGACTAGCTCCGGCGGTATCGTCAACACCGTCACCGTCACCGACAATGAGGAGTTCCGCACGA
CAGCCGAGGAAATGTACCAGACCTTTGTCGATCCATCACGACTAGCCGCATTCACTCGCTCTCCGCCGAAGCTAT
TCGAGGGCGCCAAGAAGGGCGGCAAGTTTGAGCTCTTTGGCGGCAACGTGTCCGGCGAGTACCTCGAGCTCGACG
CGCCCAAGAAGCTGGTTCAAAGTTGGCGCTTGAGCCAGTGGCCCGCCGGCCACTACTCCAAGCTTCAGATCGAGT
TTGATCAAAACGACGTTGATCACGTCACTGTCATGCGCGTCACTTGGCAAGGCGTCCCCGTTGGTCAGGAGGAGG
TGACGAAGCGCAACTGGGTCGAGTACTACGTCAAGAGCATCAAGCAAACCTTTGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail