Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2536
Gene name
LocationContig_229:2418..3768
Strand+
Gene length (bp)1350
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 9.3E-31 155 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RWM9|SWF1_NEUCR Palmitoyltransferase SWF1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swf-1 PE=3 SV=1 11 403 8.0E-132
sp|Q5BC23|SWF1_EMENI Palmitoyltransferase swf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swf1 PE=3 SV=1 1 394 3.0E-96
sp|Q4WN54|SWF1_ASPFU Palmitoyltransferase swf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swf1 PE=3 SV=1 76 386 4.0E-72
sp|O60069|SWF1_SCHPO Palmitoyltransferase swf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swf1 PE=3 SV=1 15 382 7.0E-54
sp|Q6CG20|SWF1_YARLI Palmitoyltransferase SWF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWF1 PE=3 SV=1 11 382 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RWM9|SWF1_NEUCR Palmitoyltransferase SWF1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=swf-1 PE=3 SV=1 11 403 8.0E-132
sp|Q5BC23|SWF1_EMENI Palmitoyltransferase swf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swf1 PE=3 SV=1 1 394 3.0E-96
sp|Q4WN54|SWF1_ASPFU Palmitoyltransferase swf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swf1 PE=3 SV=1 76 386 4.0E-72
sp|O60069|SWF1_SCHPO Palmitoyltransferase swf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swf1 PE=3 SV=1 15 382 7.0E-54
sp|Q6CG20|SWF1_YARLI Palmitoyltransferase SWF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWF1 PE=3 SV=1 11 382 5.0E-33
sp|Q3EBC2|ZDHC5_ARATH Probable protein S-acyltransferase 17 OS=Arabidopsis thaliana GN=PAT17 PE=2 SV=1 5 298 8.0E-33
sp|Q5A861|SWF1_CANAL Palmitoyltransferase SWF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWF1 PE=3 SV=1 4 384 2.0E-27
sp|Q6BP23|SWF1_DEBHA Palmitoyltransferase SWF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWF1 PE=3 SV=1 4 384 3.0E-27
sp|Q5FVR1|ZDHC4_RAT Probable palmitoyltransferase ZDHHC4 OS=Rattus norvegicus GN=Zdhhc4 PE=2 SV=1 8 387 6.0E-25
sp|Q58DT3|ZDHC4_BOVIN Probable palmitoyltransferase ZDHHC4 OS=Bos taurus GN=ZDHHC4 PE=2 SV=1 61 398 2.0E-24
sp|Q9D6H5|ZDHC4_MOUSE Probable palmitoyltransferase ZDHHC4 OS=Mus musculus GN=Zdhhc4 PE=2 SV=1 18 294 1.0E-23
sp|Q6FXC6|SWF1_CANGA Palmitoyltransferase SWF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWF1 PE=3 SV=1 82 384 2.0E-23
sp|Q6CJC5|SWF1_KLULA Palmitoyltransferase SWF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWF1 PE=3 SV=1 148 308 4.0E-22
sp|Q9NPG8|ZDHC4_HUMAN Probable palmitoyltransferase ZDHHC4 OS=Homo sapiens GN=ZDHHC4 PE=2 SV=1 120 294 3.0E-21
sp|Q04629|SWF1_YEAST Palmitoyltransferase SWF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWF1 PE=1 SV=2 157 384 6.0E-21
sp|Q74ZZ2|SWF1_ASHGO Palmitoyltransferase SWF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWF1 PE=3 SV=1 147 312 4.0E-19
sp|Q9SB58|ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana GN=PAT08 PE=1 SV=2 105 377 2.0E-16
sp|Q9M1K5|ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana GN=PAT04 PE=2 SV=1 87 304 7.0E-15
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 125 217 6.0E-13
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 125 217 7.0E-13
sp|Q0WQK2|ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana GN=PAT07 PE=1 SV=1 104 298 8.0E-13
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 125 217 9.0E-13
sp|Q5Y5T1|ZDH20_MOUSE Probable palmitoyltransferase ZDHHC20 OS=Mus musculus GN=Zdhhc20 PE=1 SV=1 158 228 2.0E-12
sp|Q5B3W7|ERFB_EMENI Palmitoyltransferase erf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erf2 PE=3 SV=2 69 297 2.0E-12
sp|Q8R173|ZDHC3_MOUSE Palmitoyltransferase ZDHHC3 OS=Mus musculus GN=Zdhhc3 PE=1 SV=1 81 224 2.0E-12
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 80 231 3.0E-12
sp|Q9FLM3|ZDH23_ARATH Probable protein S-acyltransferase 6 OS=Arabidopsis thaliana GN=PAT06 PE=2 SV=1 104 299 4.0E-12
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 89 226 4.0E-12
sp|Q9NYG2|ZDHC3_HUMAN Palmitoyltransferase ZDHHC3 OS=Homo sapiens GN=ZDHHC3 PE=1 SV=2 81 224 5.0E-12
sp|B3DN87|ZDH12_ARATH Probable protein S-acyltransferase 1 OS=Arabidopsis thaliana GN=PAT01 PE=2 SV=1 111 304 5.0E-12
sp|Q5Y5T3|ZDH23_MOUSE Palmitoyltransferase ZDHHC23 OS=Mus musculus GN=Zdhhc23 PE=2 SV=1 158 230 6.0E-12
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 110 218 7.0E-12
sp|Q76IC6|ZDH23_RAT Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus GN=Zdhhc23 PE=1 SV=2 158 230 8.0E-12
sp|Q6CPU8|PFA3_KLULA Palmitoyltransferase PFA3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA3 PE=3 SV=1 158 306 9.0E-12
sp|Q91WU6|ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus GN=Zdhhc7 PE=1 SV=1 128 204 1.0E-11
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 89 228 1.0E-11
sp|Q923G5|ZDHC7_RAT Palmitoyltransferase ZDHHC7 OS=Rattus norvegicus GN=Zdhhc7 PE=1 SV=1 128 204 1.0E-11
sp|Q9NXF8|ZDHC7_HUMAN Palmitoyltransferase ZDHHC7 OS=Homo sapiens GN=ZDHHC7 PE=1 SV=2 128 204 1.0E-11
sp|P59267|ZDHC2_MOUSE Palmitoyltransferase ZDHHC2 OS=Mus musculus GN=Zdhhc2 PE=2 SV=1 158 226 1.0E-11
sp|Q9UIJ5|ZDHC2_HUMAN Palmitoyltransferase ZDHHC2 OS=Homo sapiens GN=ZDHHC2 PE=2 SV=1 158 308 1.0E-11
sp|Q58DA8|ZDHC9_BOVIN Palmitoyltransferase ZDHHC9 OS=Bos taurus GN=ZDHHC9 PE=2 SV=1 72 214 1.0E-11
sp|P59268|ZDHC9_MOUSE Palmitoyltransferase ZDHHC9 OS=Mus musculus GN=Zdhhc9 PE=2 SV=1 72 214 1.0E-11
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 83 205 1.0E-11
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 108 210 1.0E-11
sp|Q4I2M7|ERFB_GIBZE Palmitoyltransferase ERF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERF2 PE=3 SV=1 78 294 2.0E-11
sp|Q9Y397|ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens GN=ZDHHC9 PE=1 SV=2 72 214 2.0E-11
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 108 210 2.0E-11
sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 110 206 2.0E-11
sp|Q9JKR5|ZDHC2_RAT Palmitoyltransferase ZDHHC2 OS=Rattus norvegicus GN=Zdhhc2 PE=2 SV=1 158 226 2.0E-11
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 108 221 2.0E-11
sp|Q4WWN2|ERFB_ASPFU Palmitoyltransferase erf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erf2 PE=3 SV=1 127 297 2.0E-11
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 109 207 2.0E-11
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 110 231 2.0E-11
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 158 218 2.0E-11
sp|Q8I0G4|ZDHC4_CAEEL Zinc finger DHHC domain-containing protein 4 OS=Caenorhabditis elegans GN=dhhc-4 PE=3 SV=1 158 301 3.0E-11
sp|Q5FWL7|ZDH15_XENLA Palmitoyltransferase ZDHHC15 OS=Xenopus laevis GN=zdhhc15 PE=2 SV=1 158 227 3.0E-11
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 121 213 4.0E-11
sp|Q5RB84|ZDH21_PONAB Probable palmitoyltransferase ZDHHC21 OS=Pongo abelii GN=ZDHHC21 PE=2 SV=1 158 306 6.0E-11
sp|Q8IVQ6|ZDH21_HUMAN Palmitoyltransferase ZDHHC21 OS=Homo sapiens GN=ZDHHC21 PE=2 SV=1 158 306 6.0E-11
sp|Q557H5|ZDHC3_DICDI Putative ZDHHC-type palmitoyltransferase 3 OS=Dictyostelium discoideum GN=DDB_G0273477 PE=3 SV=1 158 232 6.0E-11
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERF2 PE=3 SV=1 111 208 8.0E-11
sp|Q500Z2|ZDH20_ARATH Probable protein S-acyltransferase 15 OS=Arabidopsis thaliana GN=PAT15 PE=2 SV=1 129 218 1.0E-10
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 79 230 2.0E-10
sp|Q5PNZ1|ZDH21_ARATH Probable protein S-acyltransferase 3 OS=Arabidopsis thaliana GN=PAT03 PE=2 SV=1 102 304 2.0E-10
sp|Q6BMV2|PFA3_DEBHA Palmitoyltransferase PFA3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA3 PE=3 SV=2 158 321 2.0E-10
sp|Q6BHT4|ERFB_DEBHA Palmitoyltransferase ERF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERF2 PE=3 SV=2 75 206 2.0E-10
sp|Q4PE27|PFA4_USTMA Palmitoyltransferase PFA4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PFA4 PE=3 SV=2 150 211 2.0E-10
sp|O80685|ZDHC4_ARATH Probable protein S-acyltransferase 2 OS=Arabidopsis thaliana GN=PAT02 PE=2 SV=3 119 317 3.0E-10
sp|Q5R5J8|ZDHC9_PONAB Palmitoyltransferase ZDHHC9 OS=Pongo abelii GN=ZDHHC9 PE=2 SV=1 158 214 3.0E-10
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 158 308 4.0E-10
sp|Q5REH2|ZDHC6_PONAB Palmitoyltransferase ZDHHC6 OS=Pongo abelii GN=ZDHHC6 PE=3 SV=1 158 295 4.0E-10
sp|Q9H6R6|ZDHC6_HUMAN Palmitoyltransferase ZDHHC6 OS=Homo sapiens GN=ZDHHC6 PE=1 SV=1 158 295 4.0E-10
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 120 214 4.0E-10
sp|A2VDT6|ZDH21_BOVIN Probable palmitoyltransferase ZDHHC21 OS=Bos taurus GN=ZDHHC21 PE=2 SV=1 158 296 5.0E-10
sp|Q59QL0|ERFB_CANAL Palmitoyltransferase ERF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERF2 PE=3 SV=2 158 220 5.0E-10
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 158 198 5.0E-10
sp|Q14AK4|ZDH11_MOUSE Probable palmitoyltransferase ZDHHC11 OS=Mus musculus GN=Zdhhc11 PE=2 SV=2 158 339 5.0E-10
sp|Q9LIH7|ZDHC7_ARATH Protein S-acyltransferase 11 OS=Arabidopsis thaliana GN=PAT11 PE=2 SV=1 36 309 6.0E-10
sp|Q9D270|ZDH21_MOUSE Probable palmitoyltransferase ZDHHC21 OS=Mus musculus GN=Zdhhc21 PE=1 SV=2 158 296 6.0E-10
sp|Q96MV8|ZDH15_HUMAN Palmitoyltransferase ZDHHC15 OS=Homo sapiens GN=ZDHHC15 PE=2 SV=1 158 229 6.0E-10
sp|Q2TGJ4|ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus GN=Zdhhc15 PE=2 SV=1 158 229 6.0E-10
sp|Q8BGJ0|ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus GN=Zdhhc15 PE=1 SV=1 158 229 6.0E-10
sp|Q86A83|ZDHC2_DICDI Putative ZDHHC-type palmitoyltransferase 2 OS=Dictyostelium discoideum GN=DDB_G0274739 PE=2 SV=2 123 208 7.0E-10
sp|Q93VV0|ZDHC6_ARATH Probable protein S-acyltransferase 16 OS=Arabidopsis thaliana GN=PAT16 PE=2 SV=1 158 198 7.0E-10
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 148 234 7.0E-10
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 84 206 7.0E-10
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 84 206 7.0E-10
sp|O74384|ERFB_SCHPO Palmitoyltransferase erf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erf2 PE=1 SV=1 66 305 8.0E-10
sp|Q4R7E2|ZDH16_MACFA Probable palmitoyltransferase ZDHHC16 OS=Macaca fascicularis GN=ZDHHC16 PE=2 SV=1 158 201 9.0E-10
sp|Q969W1|ZDH16_HUMAN Probable palmitoyltransferase ZDHHC16 OS=Homo sapiens GN=ZDHHC16 PE=2 SV=1 158 201 9.0E-10
sp|Q7S7C5|PFA3_NEUCR Palmitoyltransferase pfa3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-3 PE=3 SV=3 158 208 9.0E-10
sp|Q9ESG8|ZDH16_MOUSE Probable palmitoyltransferase ZDHHC16 OS=Mus musculus GN=Zdhhc16 PE=1 SV=2 158 201 1.0E-09
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 78 224 1.0E-09
sp|Q75AW7|PFA3_ASHGO Palmitoyltransferase PFA3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA3 PE=3 SV=2 158 306 1.0E-09
sp|Q2THW9|ZDHC5_CANLF Palmitoyltransferase ZDHHC5 OS=Canis lupus familiaris GN=ZDHHC5 PE=2 SV=1 158 309 1.0E-09
sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus GN=ZDHHC5 PE=3 SV=1 158 309 1.0E-09
sp|Q2THX1|ZDHC5_PANTR Palmitoyltransferase ZDHHC5 OS=Pan troglodytes GN=ZDHHC5 PE=2 SV=1 158 309 1.0E-09
sp|Q9C0B5|ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens GN=ZDHHC5 PE=1 SV=2 158 309 1.0E-09
sp|Q4IA62|PFA3_GIBZE Palmitoyltransferase PFA3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA3 PE=3 SV=1 158 208 2.0E-09
sp|Q8IYP9|ZDH23_HUMAN Palmitoyltransferase ZDHHC23 OS=Homo sapiens GN=ZDHHC23 PE=1 SV=3 158 225 2.0E-09
sp|Q6C4W5|PFA3_YARLI Palmitoyltransferase PFA3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA3 PE=3 SV=1 158 320 2.0E-09
sp|Q8VDZ4|ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus GN=Zdhhc5 PE=1 SV=1 158 309 2.0E-09
sp|Q58CU4|ZDH16_BOVIN Probable palmitoyltransferase ZDHHC16 OS=Bos taurus GN=ZDHHC16 PE=2 SV=1 158 201 2.0E-09
sp|Q550R7|ZDHC1_DICDI Putative ZDHHC-type palmitoyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0276997 PE=3 SV=3 96 255 2.0E-09
sp|C8VCL4|PFA3_EMENI Palmitoyltransferase pfa3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa3 PE=3 SV=2 158 208 2.0E-09
sp|Q750R7|ERFB_ASHGO Palmitoyltransferase ERF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERF2 PE=3 SV=1 158 320 2.0E-09
sp|Q94C49|ZDH18_ARATH Probable protein S-acyltransferase 13 OS=Arabidopsis thaliana GN=PAT13 PE=2 SV=1 158 198 3.0E-09
sp|Q5R838|ZDHC5_PONAB Palmitoyltransferase ZDHHC5 OS=Pongo abelii GN=ZDHHC5 PE=2 SV=1 158 223 3.0E-09
sp|Q6FSS4|ERFB_CANGA Palmitoyltransferase ERF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERF2 PE=3 SV=1 158 208 3.0E-09
sp|Q2THW7|ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus GN=Zdhhc5 PE=1 SV=1 158 223 3.0E-09
sp|Q4WZL8|PFA3_ASPFU Palmitoyltransferase pfa3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa3 PE=3 SV=1 158 208 4.0E-09
sp|Q2HJ95|ZDHC6_BOVIN Palmitoyltransferase ZDHHC6 OS=Bos taurus GN=ZDHHC6 PE=2 SV=1 158 295 4.0E-09
sp|Q9C533|ZDHC1_ARATH Probable protein S-acyltransferase 22 OS=Arabidopsis thaliana GN=PAT22 PE=2 SV=2 158 292 4.0E-09
sp|Q9M306|ZDH10_ARATH Probable protein S-acyltransferase 5 OS=Arabidopsis thaliana GN=PAT05 PE=1 SV=2 158 298 4.0E-09
sp|Q8IZN3|ZDH14_HUMAN Probable palmitoyltransferase ZDHHC14 OS=Homo sapiens GN=ZDHHC14 PE=1 SV=1 158 299 5.0E-09
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 82 197 5.0E-09
sp|O14345|PFA3_SCHPO Palmitoyltransferase pfa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa3 PE=3 SV=1 82 266 6.0E-09
sp|Q5Y5T5|ZDHC8_MOUSE Probable palmitoyltransferase ZDHHC8 OS=Mus musculus GN=Zdhhc8 PE=1 SV=1 158 296 6.0E-09
sp|Q9ULC8|ZDHC8_HUMAN Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens GN=ZDHHC8 PE=1 SV=3 158 296 7.0E-09
sp|Q555N7|ZDHC4_DICDI Putative ZDHHC-type palmitoyltransferase 4 OS=Dictyostelium discoideum GN=DDB_G0274251 PE=3 SV=1 158 205 7.0E-09
sp|Q2THX0|ZDHC8_PANTR Probable palmitoyltransferase ZDHHC8 OS=Pan troglodytes GN=ZDHHC8 PE=2 SV=1 158 296 7.0E-09
sp|Q5FC64|ZDHCS_CAEEL Palmitoyltransferase spe-10 OS=Caenorhabditis elegans GN=spe-10 PE=1 SV=1 158 208 8.0E-09
sp|Q8VYP5|ZDH14_ARATH Probable protein S-acyltransferase 14 OS=Arabidopsis thaliana GN=PAT14 PE=2 SV=1 158 198 8.0E-09
sp|Q810M5|ZDH19_MOUSE Probable palmitoyltransferase ZDHHC19 OS=Mus musculus GN=Zdhhc19 PE=1 SV=1 158 238 8.0E-09
sp|Q2THW8|ZDHC8_CANLF Probable palmitoyltransferase ZDHHC8 OS=Canis lupus familiaris GN=ZDHHC8 PE=2 SV=1 158 294 9.0E-09
sp|Q8BQQ1|ZDH14_MOUSE Probable palmitoyltransferase ZDHHC14 OS=Mus musculus GN=Zdhhc14 PE=1 SV=1 158 299 1.0E-08
sp|Q5W0Z9|ZDH20_HUMAN Probable palmitoyltransferase ZDHHC20 OS=Homo sapiens GN=ZDHHC20 PE=1 SV=1 158 198 1.0E-08
sp|Q5Y5T2|ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus GN=Zdhhc18 PE=1 SV=4 158 299 2.0E-08
sp|Q54VH7|ZDHC8_DICDI Putative ZDHHC-type palmitoyltransferase 8 OS=Dictyostelium discoideum GN=DDB_G0280329 PE=2 SV=1 165 215 2.0E-08
sp|Q9NUE0|ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens GN=ZDHHC18 PE=2 SV=2 158 299 2.0E-08
sp|Q2TGJ1|ZDH18_RAT Palmitoyltransferase ZDHHC18 OS=Rattus norvegicus GN=Zdhhc18 PE=2 SV=1 158 299 3.0E-08
sp|Q9CPV7|ZDHC6_MOUSE Palmitoyltransferase ZDHHC6 OS=Mus musculus GN=Zdhhc6 PE=2 SV=1 158 206 3.0E-08
sp|Q552M6|ZDHC7_DICDI Putative ZDHHC-type palmitoyltransferase 7 OS=Dictyostelium discoideum GN=DDB_G0276017 PE=2 SV=1 158 201 3.0E-08
sp|Q0VC89|ZDH20_BOVIN Probable palmitoyltransferase ZDHHC20 OS=Bos taurus GN=ZDHHC20 PE=2 SV=1 158 198 4.0E-08
sp|Q8VYS8|ZDH24_ARATH Probable protein S-acyltransferase 9 OS=Arabidopsis thaliana GN=PAT09 PE=2 SV=1 120 298 4.0E-08
sp|Q06551|ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERF2 PE=1 SV=1 158 209 4.0E-08
sp|Q6UX98|ZDH24_HUMAN Probable palmitoyltransferase ZDHHC24 OS=Homo sapiens GN=ZDHHC24 PE=1 SV=1 158 228 5.0E-08
sp|Q8WVZ1|ZDH19_HUMAN Probable palmitoyltransferase ZDHHC19 OS=Homo sapiens GN=ZDHHC19 PE=2 SV=2 158 235 6.0E-08
sp|Q5M757|ZDH15_ARATH Probable protein S-acyltransferase 12 OS=Arabidopsis thaliana GN=PAT12 PE=2 SV=1 80 198 7.0E-08
sp|Q6CUB5|PFA4_KLULA Palmitoyltransferase PFA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA4 PE=3 SV=1 84 205 1.0E-07
sp|Q7XA86|ZDH11_ARATH Protein S-acyltransferase 10 OS=Arabidopsis thaliana GN=PAT10 PE=1 SV=1 151 211 1.0E-07
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA3 PE=3 SV=1 158 206 1.0E-07
sp|Q12006|PFA4_YEAST Palmitoyltransferase PFA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA4 PE=1 SV=1 78 205 1.0E-07
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 158 261 2.0E-07
sp|Q9LIE4|ZDHC8_ARATH Probable protein S-acyltransferase 20 OS=Arabidopsis thaliana GN=PAT20 PE=3 SV=2 119 310 3.0E-07
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 56 208 5.0E-07
sp|Q6IR37|ZDH24_MOUSE Probable palmitoyltransferase ZDHHC24 OS=Mus musculus GN=Zdhhc24 PE=2 SV=2 158 236 6.0E-07
sp|J9VJ99|PFA4_CRYNH Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PFA4 PE=1 SV=2 158 206 6.0E-07
sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA3 PE=1 SV=1 158 306 9.0E-07
sp|Q2TGI5|ZDH24_RAT Probable palmitoyltransferase ZDHHC24 OS=Rattus norvegicus GN=Zdhhc24 PE=2 SV=1 158 206 1.0E-06
sp|Q5AGV7|PFA4_CANAL Palmitoyltransferase PFA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA4 PE=3 SV=1 158 205 1.0E-06
sp|Q8R0N9|ZDHC1_MOUSE Probable palmitoyltransferase ZDHHC1 OS=Mus musculus GN=Zdhhc1 PE=2 SV=2 80 208 1.0E-06
sp|P0CS68|PFA4_CRYNJ Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFA4 PE=3 SV=2 158 206 1.0E-06
sp|P0CS69|PFA4_CRYNB Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFA4 PE=3 SV=1 158 206 1.0E-06
sp|Q8WTX9|ZDHC1_HUMAN Probable palmitoyltransferase ZDHHC1 OS=Homo sapiens GN=ZDHHC1 PE=2 SV=1 80 208 1.0E-06
sp|Q6BLY8|PFA4_DEBHA Palmitoyltransferase PFA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA4 PE=3 SV=2 158 197 2.0E-06
sp|Q75CB4|PFA4_ASHGO Palmitoyltransferase PFA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA4 PE=3 SV=2 156 205 2.0E-06
sp|Q8L5Y5|ZDH17_ARATH Probable protein S-acyltransferase 19 OS=Arabidopsis thaliana GN=PAT19 PE=2 SV=1 158 294 3.0E-06
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 158 205 4.0E-06
sp|Q9H8X9|ZDH11_HUMAN Probable palmitoyltransferase ZDHHC11 OS=Homo sapiens GN=ZDHHC11 PE=2 SV=1 95 211 7.0E-06
sp|Q9M115|ZDH16_ARATH Protein S-acyltransferase 18 OS=Arabidopsis thaliana GN=PAT18 PE=2 SV=2 158 202 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 78 100 22
3 105 127 22
4 201 223 22
5 266 288 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2536
MASFKWAVIFVLSLSFFVFVTFFGRLPALRRTPVGGLHRLLWIHVPAALCALDDRLTSGRLTRWLLSFGSFMLHD
RHPTIVIFFLAILIGSQYMFLVEAWSLMNWAVSLLAIVVGFMPYLFLYLSCASDPGYITPDNHAYYMSLYPYDYA
LFHPGNECRTCGLLKPARSKHCSICKRCIARADHHCVFINSCVGYGNHHWFVLLLVSTLCLDLYGAVVGISLLNR
LIKHRHANWSLWKPNDMTFSRYLAVWGWAIQMNVRIGATTLLAMLTTPLVTGLLVYTLYLVYAGTTTNESLKWSV
VKEDMDDGCAFRRVLPPNRKKDDRIESWCCRWPVEPTHILVGTSDGQPPAADAGLQGDGEWEHVWSLKHVENIYD
VGFWDNLTDSFVRDYAFGKRAGEASARESRNWA*
Coding >Ophun1|2536
ATGGCGTCGTTCAAGTGGGCGGTTATTTTCGTCCTCTCCCTGTCCTTCTTCGTCTTCGTCACCTTCTTCGGCAGG
CTTCCTGCTCTCAGACGTACACCCGTAGGCGGCTTGCACCGTCTGCTTTGGATACACGTGCCTGCCGCCCTGTGC
GCTTTGGACGACAGGCTCACTTCCGGAAGACTGACGAGATGGCTCCTGAGCTTCGGGAGTTTCATGTTGCACGAT
CGTCATCCAACCATCGTGATCTTCTTCCTAGCCATCCTCATAGGCTCCCAATACATGTTCCTGGTGGAGGCATGG
TCACTCATGAACTGGGCCGTCTCGCTGCTCGCCATCGTCGTCGGCTTCATGCCCTATCTCTTCCTCTACCTCTCG
TGTGCCAGCGACCCGGGATACATCACCCCCGACAACCACGCCTACTACATGTCCCTCTACCCCTACGACTACGCC
CTCTTCCACCCCGGGAATGAGTGCCGCACCTGTGGCCTGCTGAAACCTGCCCGGTCCAAGCACTGCAGCATCTGC
AAGCGCTGCATTGCCAGGGCCGACCATCACTGCGTCTTCATCAACTCGTGCGTTGGCTACGGTAACCATCACTGG
TTCGTCTTGCTCCTGGTTTCTACCCTTTGCCTGGACTTGTACGGCGCCGTGGTCGGCATATCGCTCCTGAATCGA
TTGATCAAGCATCGCCATGCGAACTGGTCTTTGTGGAAACCAAACGACATGACGTTCAGCAGATATTTGGCCGTC
TGGGGCTGGGCCATCCAGATGAACGTACGGATAGGCGCCACGACTCTCCTGGCCATGCTCACGACCCCGCTGGTA
ACCGGCCTCCTCGTCTATACCCTCTACCTGGTCTACGCCGGCACCACCACCAATGAGTCTCTCAAATGGTCCGTC
GTCAAAGAGGACATGGACGATGGCTGCGCCTTCCGCCGCGTCCTCCCGCCCAACCGGAAGAAAGACGACCGTATC
GAGTCCTGGTGCTGCCGCTGGCCGGTCGAGCCGACGCATATCCTCGTCGGCACCTCTGACGGCCAGCCACCGGCC
GCAGACGCCGGTCTGCAGGGTGACGGCGAGTGGGAGCACGTGTGGAGTCTGAAGCACGTAGAGAACATTTATGAC
GTGGGATTTTGGGATAACTTGACGGATTCGTTCGTACGGGATTATGCCTTTGGAAAACGAGCTGGTGAGGCGTCT
GCTCGCGAATCAAGGAACTGGGCATGA
Transcript >Ophun1|2536
ATGGCGTCGTTCAAGTGGGCGGTTATTTTCGTCCTCTCCCTGTCCTTCTTCGTCTTCGTCACCTTCTTCGGCAGG
CTTCCTGCTCTCAGACGTACACCCGTAGGCGGCTTGCACCGTCTGCTTTGGATACACGTGCCTGCCGCCCTGTGC
GCTTTGGACGACAGGCTCACTTCCGGAAGACTGACGAGATGGCTCCTGAGCTTCGGGAGTTTCATGTTGCACGAT
CGTCATCCAACCATCGTGATCTTCTTCCTAGCCATCCTCATAGGCTCCCAATACATGTTCCTGGTGGAGGCATGG
TCACTCATGAACTGGGCCGTCTCGCTGCTCGCCATCGTCGTCGGCTTCATGCCCTATCTCTTCCTCTACCTCTCG
TGTGCCAGCGACCCGGGATACATCACCCCCGACAACCACGCCTACTACATGTCCCTCTACCCCTACGACTACGCC
CTCTTCCACCCCGGGAATGAGTGCCGCACCTGTGGCCTGCTGAAACCTGCCCGGTCCAAGCACTGCAGCATCTGC
AAGCGCTGCATTGCCAGGGCCGACCATCACTGCGTCTTCATCAACTCGTGCGTTGGCTACGGTAACCATCACTGG
TTCGTCTTGCTCCTGGTTTCTACCCTTTGCCTGGACTTGTACGGCGCCGTGGTCGGCATATCGCTCCTGAATCGA
TTGATCAAGCATCGCCATGCGAACTGGTCTTTGTGGAAACCAAACGACATGACGTTCAGCAGATATTTGGCCGTC
TGGGGCTGGGCCATCCAGATGAACGTACGGATAGGCGCCACGACTCTCCTGGCCATGCTCACGACCCCGCTGGTA
ACCGGCCTCCTCGTCTATACCCTCTACCTGGTCTACGCCGGCACCACCACCAATGAGTCTCTCAAATGGTCCGTC
GTCAAAGAGGACATGGACGATGGCTGCGCCTTCCGCCGCGTCCTCCCGCCCAACCGGAAGAAAGACGACCGTATC
GAGTCCTGGTGCTGCCGCTGGCCGGTCGAGCCGACGCATATCCTCGTCGGCACCTCTGACGGCCAGCCACCGGCC
GCAGACGCCGGTCTGCAGGGTGACGGCGAGTGGGAGCACGTGTGGAGTCTGAAGCACGTAGAGAACATTTATGAC
GTGGGATTTTGGGATAACTTGACGGATTCGTTCGTACGGGATTATGCCTTTGGAAAACGAGCTGGTGAGGCGTCT
GCTCGCGAATCAAGGAACTGGGCATGA
Gene >Ophun1|2536
ATGGCGTCGTTCAAGTGGGCGGTTATTTTCGTCCTCTCCCTGTCCTTCTTCGTCTTCGTCACCTTCTTCGGCAGG
CTTCCTGCTCTCAGGTGAGAGCCTCTGTGGCTCAGCCTCTGTGGCTCATCGTCGTTCTCGGCGTGCTGACCCTCG
CTTCTCAGACGTACACCCGTAGGCGGCTTGCACCGTCTGCTTTGGATACACGTGCCTGCCGCCCTGTGCGCTTTG
GACGACAGGCTCACTTCCGGAAGACTGACGAGATGGCTCCTGAGCTTCGGGAGTTTCATGTTGCACGATCGTCAT
CCAACCATCGTGGTACGTCGATCAGCCCGCCCTCGCCGCTGCCCTCAGCCACTCAAGCCTCTATAGATCTTCTTC
CTAGCCATCCTCATAGGCTCCCAATACATGTTCCTGGTGGAGGCATGGTCACTCATGAACTGGGCCGTCTCGCTG
CTCGCCATCGTCGTCGGCTTCATGCCCTATCTCTTCCTCTACCTCTCGTGTGCCAGCGACCCGGGATACATCACC
CCCGACAACCACGCCTACTACATGTCCCTCTACCCCTACGACTACGCCCTCTTCCACCCCGGGAATGAGTGCCGC
ACCTGTGGCCTGCTGAAACCTGCCCGGTCCAAGCACTGCAGCATCTGCAAGCGCTGCATTGCCAGGGCCGACCAT
CACTGCGTCTTCATCAACTCGTGCGTTGGCTACGGTAACCATCACTGGTTCGTCTTGCTCCTGGTTTCTACCCTT
TGCCTGGACTTGTACGGCGCCGTGGTCGGCATATCGCTCCTGAATCGATTGATCAAGCATCGCCATGCGAACTGG
TCTTTGTGGAAACCAAACGACATGACGTTCAGCAGATATTTGGCCGTCTGGGGCTGGGCCATCCAGATGAACGTA
CGGATAGGCGCCACGACTCTCCTGGCCATGCTCACGACCCCGCTGGTAACCGGCCTCCTCGTCTATACCCTCTAC
CTGGTCTACGCCGGCACCACCACCAATGAGTCTCTCAAATGGTCCGTCGTCAAAGAGGACATGGACGATGGCTGC
GCCTTCCGCCGCGTCCTCCCGCCCAACCGGAAGAAAGACGACCGTATCGAGTCCTGGTGCTGCCGCTGGCCGGTC
GAGCCGACGCATATCCTCGTCGGCACCTCTGACGGCCAGCCACCGGCCGCAGACGCCGGTCTGCAGGGTGACGGC
GAGTGGGAGCACGTGTGGAGTCTGAAGCACGTAGAGAACATTTATGACGTGGGATTTTGGGATAACTTGACGGAT
TCGTTCGTACGGGATTATGCCTTTGGAAAACGAGCTGGTGAGGCGTCTGCTCGCGAATCAAGGAACTGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail