Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2531
Gene name
LocationContig_228:15557..16227
Strand-
Gene length (bp)670
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999714

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6977
Ophiocordyceps australis map64 (Brazil) OphauB2|4294
Ophiocordyceps camponoti-floridani Ophcf2|02081
Ophiocordyceps camponoti-floridani Ophcf2|02093
Ophiocordyceps camponoti-floridani Ophcf2|07411
Ophiocordyceps camponoti-rufipedis Ophun1|2531 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|730
Ophiocordyceps kimflemingae Ophio5|508
Ophiocordyceps kimflemingae Ophio5|8326
Ophiocordyceps subramaniannii Hirsu2|10709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2531
MKLPVVLSQLLLGGLASAQVNTNQSRPFQLVIHSGNRHINGMTFTACHTGAAIESLCVFKGSGSAFYFNKSASSQ
PPLKDYEPLGVLVWNLPIDPSPYSEAMTLSHEPSSNVALPLFQPSSLPQLVTFDNQNRLSIISYIDDSRNPPVGG
KPRALRNWYLCHTFYSGYTYRTLTWVFGNGLAKPQNPSCIKIDVRRRYLDAGARA*
Coding >Ophun1|2531
ATGAAGCTACCCGTCGTTCTGTCCCAGCTGCTCCTCGGCGGCCTGGCCTCAGCACAGGTCAACACGAACCAGTCT
CGGCCTTTCCAGTTGGTCATTCACTCTGGCAACAGACATATCAATGGCATGACATTTACAGCTTGTCACACGGGC
GCCGCCATAGAGTCCCTCTGCGTCTTTAAAGGCAGCGGCTCTGCTTTCTACTTTAATAAGTCGGCAAGTTCTCAG
CCTCCGTTGAAGGACTACGAGCCTCTCGGGGTGCTGGTGTGGAATCTGCCCATCGACCCGAGTCCCTACTCCGAA
GCCATGACCTTGTCCCACGAGCCCTCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTTGCCGCAACTT
GTCACCTTCGATAACCAGAATCGTCTATCCATCATCAGCTACATAGACGACAGCCGCAACCCACCCGTGGGCGGA
AAGCCGCGGGCGCTGAGGAACTGGTATCTGTGCCACACGTTTTACTCGGGATATACCTACCGGACCCTGACCTGG
GTCTTTGGCAATGGATTGGCGAAGCCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTTGAT
GCTGGGGCGAGGGCTTGA
Transcript >Ophun1|2531
ATGAAGCTACCCGTCGTTCTGTCCCAGCTGCTCCTCGGCGGCCTGGCCTCAGCACAGGTCAACACGAACCAGTCT
CGGCCTTTCCAGTTGGTCATTCACTCTGGCAACAGACATATCAATGGCATGACATTTACAGCTTGTCACACGGGC
GCCGCCATAGAGTCCCTCTGCGTCTTTAAAGGCAGCGGCTCTGCTTTCTACTTTAATAAGTCGGCAAGTTCTCAG
CCTCCGTTGAAGGACTACGAGCCTCTCGGGGTGCTGGTGTGGAATCTGCCCATCGACCCGAGTCCCTACTCCGAA
GCCATGACCTTGTCCCACGAGCCCTCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTTGCCGCAACTT
GTCACCTTCGATAACCAGAATCGTCTATCCATCATCAGCTACATAGACGACAGCCGCAACCCACCCGTGGGCGGA
AAGCCGCGGGCGCTGAGGAACTGGTATCTGTGCCACACGTTTTACTCGGGATATACCTACCGGACCCTGACCTGG
GTCTTTGGCAATGGATTGGCGAAGCCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTTGAT
GCTGGGGCGAGGGCTTGA
Gene >Ophun1|2531
ATGAAGCTACCCGTCGTTCTGTCCCAGCTGCTCCTCGGCGGCCTGGCCTCAGCACAGGTCAACACGAACCAGTCT
CGGCCTTTCCAGTTGGTCATTCACTCTGGCAACAGACATATCAATGGCATGACATTTACAGCTTGTCACACGGGC
GCCGCCATAGAGTCCCTCTGCGTCTTTAAAGGCAGCGGCTCTGCTTTCTACTTTAATAAGTCGGCAAGTTCTCAG
CCTCCGTTGAAGGACTACGAGCCTCTCGGGGTGCTGGTGTGGAATCTGCCCATCGGTAAGACCGTCCAGTTTCAA
AGCAACAATATCTTTAGTTAACACGTCAAAAGACCCGAGTCCCTACTCCGAAGCCATGACCTTGTCCCACGAGCC
CTCCTCCAACGTAGCGCTACCGCTATTCCAGCCCAGCTCGTTGCCGCAACTTGTCACCTTCGATAACCAGAATCG
TCTATCCATCATCAGCTACATAGACGACAGCCGCAACCCACCCGTGGGCGGAAAGCCGCGGGCGCTGAGGAACTG
GTATCTGTGCCACACGTTTTACTCGGGATATACCTACCGGACCCTGACCTGGGTCTTTGGCAATGGATTGGCGAA
GCCTCAGAATCCGAGCTGTATCAAGATTGATGTGCGGCGCAGATACCTTGATGCTGGGGCGAGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail