Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2528
Gene name
LocationContig_228:8588..9470
Strand-
Gene length (bp)882
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04252 RNA_Me_trans Predicted SAM-dependent RNA methyltransferase 1.4E-71 7 196

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12314|SFM1_YEAST Protein arginine N-methyltransferase SFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFM1 PE=1 SV=1 7 202 3.0E-47

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4419
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7791
Ophiocordyceps australis map64 (Brazil) OphauB2|5271
Ophiocordyceps camponoti-floridani Ophcf2|02096
Ophiocordyceps camponoti-rufipedis Ophun1|2528 (this protein)
Ophiocordyceps kimflemingae Ophio5|504
Ophiocordyceps subramaniannii Hirsu2|9149

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2528
MANGQTFIVEHLDPELGPWSALEYSAIATETHQSGPQNRFVLSSLPAAFRVPEALSSNPAFTAERRGVEELYAAD
KSSVCLLDPAASRDLAPVDGQTFRVFLFGGILDRTSELRKKGFEGRRLGPKQMTTDTAVRVTRMVVRDGIPLDEI
PYVDFPELKFNDHESTKMPFRYVVDDEGNPVMPQGMKELIEKDADKPIDDLF*
Coding >Ophun1|2528
ATGGCAAACGGCCAAACCTTCATCGTCGAACACCTCGACCCCGAACTCGGCCCCTGGTCCGCCCTCGAATACTCC
GCCATCGCAACCGAGACGCACCAATCCGGCCCGCAGAACCGCTTCGTCCTCTCCAGCCTCCCCGCCGCCTTCCGC
GTACCGGAAGCCCTCTCGTCCAACCCAGCCTTCACGGCCGAGCGACGAGGCGTCGAAGAGCTGTACGCGGCCGAT
AAGTCGTCCGTCTGCCTGCTGGACCCTGCCGCCTCCCGAGACCTGGCCCCGGTCGATGGCCAGACGTTCCGCGTC
TTCCTCTTTGGCGGCATTCTAGACCGCACCTCTGAGCTGAGGAAAAAGGGGTTCGAGGGCCGCAGGCTGGGGCCT
AAACAGATGACCACCGACACGGCCGTGCGTGTGACTCGCATGGTTGTGCGAGACGGGATTCCCTTGGACGAAATT
CCTTATGTCGATTTCCCCGAACTCAAGTTTAACGATCACGAGAGCACAAAGATGCCCTTTCGTTACGTAGTCGAC
GACGAGGGCAACCCCGTTATGCCACAGGGAATGAAGGAACTGATAGAAAAGGACGCCGACAAGCCCATCGACGAT
CTCTTCTAG
Transcript >Ophun1|2528
ATGGCAAACGGCCAAACCTTCATCGTCGAACACCTCGACCCCGAACTCGGCCCCTGGTCCGCCCTCGAATACTCC
GCCATCGCAACCGAGACGCACCAATCCGGCCCGCAGAACCGCTTCGTCCTCTCCAGCCTCCCCGCCGCCTTCCGC
GTACCGGAAGCCCTCTCGTCCAACCCAGCCTTCACGGCCGAGCGACGAGGCGTCGAAGAGCTGTACGCGGCCGAT
AAGTCGTCCGTCTGCCTGCTGGACCCTGCCGCCTCCCGAGACCTGGCCCCGGTCGATGGCCAGACGTTCCGCGTC
TTCCTCTTTGGCGGCATTCTAGACCGCACCTCTGAGCTGAGGAAAAAGGGGTTCGAGGGCCGCAGGCTGGGGCCT
AAACAGATGACCACCGACACGGCCGTGCGTGTGACTCGCATGGTTGTGCGAGACGGGATTCCCTTGGACGAAATT
CCTTATGTCGATTTCCCCGAACTCAAGTTTAACGATCACGAGAGCACAAAGATGCCCTTTCGTTACGTAGTCGAC
GACGAGGGCAACCCCGTTATGCCACAGGGAATGAAGGAACTGATAGAAAAGGACGCCGACAAGCCCATCGACGAT
CTCTTCTAG
Gene >Ophun1|2528
ATGGCAAACGGCCAAACCTTCATCGTCGAACACCTCGACCCCGAACTCGGCCCCTGGTCCGCCCTCGAATACTCC
GCCATCGCAACCGAGACGCACCAATCCGGCCCGCAGAACCGCTTCGTCCTCTCCAGCCTCCCCGCCGCCTTCCGC
GTACCGGAAGCCCTCTCGTCCAACCCAGCCTTCACGGCCGAGCGACGAGGCGTCGAAGAGCTGTACGCGGCCGAT
AAGTCGTCCGTCTGCCTGCTGGACCCTGCCGCCTCCCGAGACCTGGCCCCGGTCGATGGCCAGACGTTCCGCGTC
TTCCTCTTTGGCGGCATTCTAGGTACTGCTTTCTTCTTGGCGGCAGCCAGCCGTTGACTGACGTGTTCCTCATCA
CACAGGTGATGATCCTCCTCGAGGTAACCCCTGGCCAGCTTGTCTTCTCTTGGCCTCCGACGACACTGATTCTCG
TTGTTGTCTAGACCGCACCTCTGAGCTGAGGAAAAAGGGGTTCGAGGGCCGCAGGCTGGGGCCTAAACAGATGAC
CACCGACACGGCCGTGCGTGTGACTCGCATGGTTGTGCGAGACGGGAGTACGTTTGGCCCCTCGACCGTCAAACA
TGTCATACATGTTTTTGGGCTGAAGAATCGACACCCTTTTACAGTTCCCTTGGACGAAATTCCTTATGTCGATTT
CCCCGAACTCAAGTTTAACGATCACGAGAGCACAAAGATGCCCTTTCGTTACGTAGTCGACGACGAGGGCAACCC
CGTTATGCCACAGGTGAGATCAAACGCGCCCCGACAATGACTGCCAACAGGTTGTGGACTGATAGACCGATCAAG
GGAATGAAGGAACTGATAGAAAAGGACGCCGACAAGCCCATCGACGATCTCTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail