Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2525
Gene name
LocationContig_227:23277..23724
Strand+
Gene length (bp)447
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999641

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|455
Ophiocordyceps australis map64 (Brazil) OphauB2|264
Ophiocordyceps australis map64 (Brazil) OphauB2|7295
Ophiocordyceps camponoti-rufipedis Ophun1|2525 (this protein)
Ophiocordyceps kimflemingae Ophio5|7787
Ophiocordyceps subramaniannii Hirsu2|3556

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2525
MKAAMVLPAMLVGLASAQMRFQDTIPPGSAPHANGGGGLANGKGLPGGGTLRSNLNAGAPLGRNIMPVARVLPDG
GGGAAARISATVGRIASTLGRAGPIVAGGAAAAGLGVAGIAQGERNLEDLHPDVAESARKGLERGLSEYIFRA*
Coding >Ophun1|2525
ATGAAGGCTGCAATGGTCCTCCCTGCTATGCTTGTCGGACTTGCTTCAGCACAAATGCGGTTCCAGGATACAATC
CCGCCGGGATCCGCGCCACACGCCAACGGGGGTGGCGGTCTTGCAAATGGGAAAGGGCTTCCTGGGGGAGGAACG
CTTCGGTCGAATCTAAATGCTGGCGCACCACTAGGGAGAAACATTATGCCAGTTGCAAGGGTCCTGCCGGATGGC
GGTGGCGGTGCAGCAGCCCGGATAAGTGCTACGGTTGGGAGGATCGCCAGTACGTTGGGAAGAGCAGGACCTATT
GTAGCAGGAGGCGCTGCAGCTGCTGGACTTGGGGTTGCAGGAATCGCTCAAGGAGAAAGGAACCTAGAGGATTTA
CACCCTGATGTTGCTGAAAGCGCTCGAAAGGGATTAGAAAGGGGACTCTCGGAGTACATATTCCGAGCATAG
Transcript >Ophun1|2525
ATGAAGGCTGCAATGGTCCTCCCTGCTATGCTTGTCGGACTTGCTTCAGCACAAATGCGGTTCCAGGATACAATC
CCGCCGGGATCCGCGCCACACGCCAACGGGGGTGGCGGTCTTGCAAATGGGAAAGGGCTTCCTGGGGGAGGAACG
CTTCGGTCGAATCTAAATGCTGGCGCACCACTAGGGAGAAACATTATGCCAGTTGCAAGGGTCCTGCCGGATGGC
GGTGGCGGTGCAGCAGCCCGGATAAGTGCTACGGTTGGGAGGATCGCCAGTACGTTGGGAAGAGCAGGACCTATT
GTAGCAGGAGGCGCTGCAGCTGCTGGACTTGGGGTTGCAGGAATCGCTCAAGGAGAAAGGAACCTAGAGGATTTA
CACCCTGATGTTGCTGAAAGCGCTCGAAAGGGATTAGAAAGGGGACTCTCGGAGTACATATTCCGAGCATAG
Gene >Ophun1|2525
ATGAAGGCTGCAATGGTCCTCCCTGCTATGCTTGTCGGACTTGCTTCAGCACAAATGCGGTTCCAGGATACAATC
CCGCCGGGATCCGCGCCACACGCCAACGGGGGTGGCGGTCTTGCAAATGGGAAAGGGCTTCCTGGGGGAGGAACG
CTTCGGTCGAATCTAAATGCTGGCGCACCACTAGGGAGAAACATTATGCCAGTTGCAAGGGTCCTGCCGGATGGC
GGTGGCGGTGCAGCAGCCCGGATAAGTGCTACGGTTGGGAGGATCGCCAGTACGTTGGGAAGAGCAGGACCTATT
GTAGCAGGAGGCGCTGCAGCTGCTGGACTTGGGGTTGCAGGAATCGCTCAAGGAGAAAGGAACCTAGAGGATTTA
CACCCTGATGTTGCTGAAAGCGCTCGAAAGGGATTAGAAAGGGGACTCTCGGAGTACATATTCCGAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail