Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2514
Gene name
LocationContig_226:26210..26761
Strand+
Gene length (bp)551
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999465

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6674
Ophiocordyceps australis map64 (Brazil) OphauB2|4345
Ophiocordyceps camponoti-floridani Ophcf2|00309
Ophiocordyceps camponoti-rufipedis Ophun1|1838
Ophiocordyceps camponoti-rufipedis Ophun1|2514 (this protein)
Ophiocordyceps kimflemingae Ophio5|1373
Ophiocordyceps subramaniannii Hirsu2|4665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2514
MKSTMAMSLLAAATVQAGQAYGTDSSGPAFLNVQGDYDSAKAGQNFNIKLTGCDASCTVIPKQGQAENLQNIPGA
PSITVTGSSATLRIPEGYEKVAFVVTDNKGNVNYSPQFAPGGAKQD*
Coding >Ophun1|2514
ATGAAGTCAACCATGGCCATGTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCCAGGCCTATGGCACCGACAGC
TCGGGTCCTGCCTTCCTCAACGTCCAGGGCGACTACGACAGCGCCAAGGCGGGCCAGAATTTCAACATCAAGTTA
ACAGGCTGCGACGCCAGCTGCACCGTTATCCCCAAGCAGGGTCAGGCCGAGAACTTGCAGAACATCCCGGGCGCG
CCCAGCATCACCGTCACCGGCTCGTCTGCAACCCTCCGGATTCCCGAGGGCTACGAAAAGGTGGCCTTTGTCGTC
ACCGACAACAAGGGCAACGTCAACTACAGCCCGCAGTTTGCCCCCGGCGGTGCCAAACAAGATTGA
Transcript >Ophun1|2514
ATGAAGTCAACCATGGCCATGTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCCAGGCCTATGGCACCGACAGC
TCGGGTCCTGCCTTCCTCAACGTCCAGGGCGACTACGACAGCGCCAAGGCGGGCCAGAATTTCAACATCAAGTTA
ACAGGCTGCGACGCCAGCTGCACCGTTATCCCCAAGCAGGGTCAGGCCGAGAACTTGCAGAACATCCCGGGCGCG
CCCAGCATCACCGTCACCGGCTCGTCTGCAACCCTCCGGATTCCCGAGGGCTACGAAAAGGTGGCCTTTGTCGTC
ACCGACAACAAGGGCAACGTCAACTACAGCCCGCAGTTTGCCCCCGGCGGTGCCAAACAAGATTGA
Gene >Ophun1|2514
ATGAAGTCAACCATGGCCATGTCCCTCCTCGCCGCCGCCACCGTCCAGGCTGGCCAGGCCTATGGCACCGACAGC
TCGGGTCCTGCCTTCCTCAACGTCCAGGGCGACTACGACAGCGCCAAGGCGGGCCAGAATTTCAACATCAAGTTA
ACAGGCTGCGACGCCAGCTGCACCGTTATCCCCAAGCAGGGTCAGGCCGAGAACTTGCAGAACATCCCGGGCGCG
CCCAGCAGTTCGTCTTGCTCTTGCTCTTGCTCGTCCTTGTACTATTGTTGACCTTGTTCAGTCACCGTCACCGGC
TCGTCTGCAACCCTCCGGATTCCCGAGGGCTACGAAAAGGTGGCCTTTGTCGTCACCGACAACAAGGGCAACGTC
AACTACAGCCCGCAGTTTGCCCCCGGCGGTGCCAGTGCGAATCCCGCGCCCGCTCCCGCTCCCGCGCCCGCCCCT
GCCCCTGCCCCTGCCCCTGCCGACAAGGACAAGAACAACGACGACAAGAACAAGAATAACGACAACAAGGACAAG
AACAATGACGATCAGAACAAGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail