Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2513
Gene name
LocationContig_226:22873..24507
Strand+
Gene length (bp)1634
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase 6.0E-189 52 466

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59KI0|UGP1_CANAL UTP--glucose-1-phosphate uridylyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UGP1 PE=1 SV=1 28 501 0.0E+00
sp|P78811|UGPA1_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fyu1 PE=1 SV=2 15 501 0.0E+00
sp|P32861|UGPA1_YEAST UTP--glucose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGP1 PE=1 SV=1 15 501 0.0E+00
sp|Q16851|UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens GN=UGP2 PE=1 SV=5 49 501 6.0E-180
sp|O35156|UGPA_CRIGR UTP--glucose-1-phosphate uridylyltransferase OS=Cricetulus griseus GN=UGP2 PE=2 SV=3 49 501 8.0E-180
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59KI0|UGP1_CANAL UTP--glucose-1-phosphate uridylyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UGP1 PE=1 SV=1 28 501 0.0E+00
sp|P78811|UGPA1_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fyu1 PE=1 SV=2 15 501 0.0E+00
sp|P32861|UGPA1_YEAST UTP--glucose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGP1 PE=1 SV=1 15 501 0.0E+00
sp|Q16851|UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens GN=UGP2 PE=1 SV=5 49 501 6.0E-180
sp|O35156|UGPA_CRIGR UTP--glucose-1-phosphate uridylyltransferase OS=Cricetulus griseus GN=UGP2 PE=2 SV=3 49 501 8.0E-180
sp|Q91ZJ5|UGPA_MOUSE UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus GN=Ugp2 PE=1 SV=3 49 501 9.0E-179
sp|Q07130|UGPA_BOVIN UTP--glucose-1-phosphate uridylyltransferase OS=Bos taurus GN=UGP2 PE=1 SV=2 49 501 7.0E-178
sp|P79303|UGPA_PIG UTP--glucose-1-phosphate uridylyltransferase OS=Sus scrofa GN=UGP2 PE=2 SV=3 49 501 1.0E-176
sp|Q54YZ0|UGPA2_DICDI UTP--glucose-1-phosphate uridylyltransferase 2 OS=Dictyostelium discoideum GN=ugpB PE=2 SV=1 12 496 4.0E-175
sp|O59819|UGPA2_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.10 PE=3 SV=1 16 500 9.0E-168
sp|P57751|UGPA1_ARATH UTP--glucose-1-phosphate uridylyltransferase 1 OS=Arabidopsis thaliana GN=At5g17310 PE=2 SV=1 27 494 1.0E-166
sp|Q9SDX3|UGPA_MUSAC UTP--glucose-1-phosphate uridylyltransferase OS=Musa acuminata GN=UGPA PE=2 SV=1 46 494 9.0E-166
sp|Q9LKG7|UGPA_ASTPN UTP--glucose-1-phosphate uridylyltransferase OS=Astragalus penduliflorus GN=UGP PE=2 SV=1 23 494 1.0E-162
sp|Q9M9P3|UGPA2_ARATH Probable UTP--glucose-1-phosphate uridylyltransferase 2 OS=Arabidopsis thaliana GN=At3g03250 PE=1 SV=1 27 494 2.0E-162
sp|Q43772|UGPA_HORVU UTP--glucose-1-phosphate uridylyltransferase OS=Hordeum vulgare PE=2 SV=1 28 494 8.0E-162
sp|P19595|UGPA_SOLTU UTP--glucose-1-phosphate uridylyltransferase OS=Solanum tuberosum PE=1 SV=3 19 494 1.0E-160
sp|O64459|UGPA_PYRPY UTP--glucose-1-phosphate uridylyltransferase OS=Pyrus pyrifolia PE=2 SV=1 46 494 9.0E-158
sp|Q8SSC5|UGPA1_ENCCU UTP--glucose-1-phosphate uridylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=UGP1 PE=1 SV=1 16 501 3.0E-148
sp|P08800|UGPA1_DICDI UTP--glucose-1-phosphate uridylyltransferase 1 OS=Dictyostelium discoideum GN=uppA PE=2 SV=2 75 501 6.0E-127
sp|P38709|UGPA2_YEAST Probable UTP--glucose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL012W PE=3 SV=1 13 492 7.0E-88
sp|Q49ZB5|URTF_STAS1 Probable uridylyltransferase SSP0716 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0716 PE=3 SV=1 54 390 5.0E-14
sp|Q8CNG6|URTF_STAES Probable uridylyltransferase SE_1761 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1761 PE=3 SV=1 88 390 4.0E-13
sp|Q5HM59|URTF_STAEQ Probable uridylyltransferase SERP1770 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1770 PE=3 SV=1 88 390 1.0E-12
sp|Q6GEQ8|URTF_STAAR Probable uridylyltransferase SAR2262 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2262 PE=3 SV=1 102 328 1.0E-12
sp|Q5HE34|URTF_STAAC Probable uridylyltransferase SACOL2161 OS=Staphylococcus aureus (strain COL) GN=SACOL2161 PE=3 SV=1 102 328 2.0E-12
sp|Q2FW81|URTF_STAA8 Probable uridylyltransferase SAOUHSC_02423 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02423 PE=3 SV=1 102 328 2.0E-12
sp|Q2FEW1|URTF_STAA3 Probable uridylyltransferase SAUSA300_2130 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2130 PE=3 SV=1 102 328 2.0E-12
sp|Q7A0A0|URTF_STAAW Probable uridylyltransferase MW2097 OS=Staphylococcus aureus (strain MW2) GN=MW2097 PE=3 SV=1 102 328 5.0E-12
sp|Q6G7E3|URTF_STAAS Probable uridylyltransferase SAS2072 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2072 PE=3 SV=1 102 328 5.0E-12
sp|Q7A4A4|URTF_STAAN Probable uridylyltransferase SA1974 OS=Staphylococcus aureus (strain N315) GN=SA1974 PE=1 SV=1 102 328 5.0E-12
sp|Q99S95|URTF_STAAM Probable uridylyltransferase SAV2171 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2171 PE=3 SV=1 102 328 5.0E-12
sp|Q2YYH4|URTF_STAAB Probable uridylyltransferase SAB2052c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2052c PE=3 SV=1 102 328 1.0E-11
sp|Q4L846|URTF_STAHJ Probable uridylyltransferase SH0870 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0870 PE=3 SV=1 102 247 1.0E-10
sp|O64765|UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana GN=GLCNAC1PUT2 PE=1 SV=1 99 284 9.0E-10
sp|Q3KQV9|UAP1L_HUMAN UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Homo sapiens GN=UAP1L1 PE=1 SV=2 100 320 1.0E-08
sp|Q91YN5|UAP1_MOUSE UDP-N-acetylhexosamine pyrophosphorylase OS=Mus musculus GN=Uap1 PE=1 SV=1 82 348 1.0E-08
sp|Q16222|UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens GN=UAP1 PE=1 SV=3 101 298 2.0E-08
sp|O94617|UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap1 PE=1 SV=1 44 315 9.0E-08
sp|Q3TW96|UAP1L_MOUSE UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 OS=Mus musculus GN=Uap1l1 PE=1 SV=1 100 320 2.0E-07
sp|O74933|UAP1_CANAX UDP-N-acetylglucosamine pyrophosphorylase OS=Candida albicans GN=UAP1 PE=1 SV=1 102 305 6.0E-07
sp|Q940S3|UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana GN=GLCNAC1PUT1 PE=1 SV=1 99 284 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0070569 uridylyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2513
MAPSIINGLTVPQKAFENTSTNVAAAQMRNALTNLAETVEDPQQKKLFQTEMDNFFALFRRYLNDKAEGNAVNWD
RIAPPAQGQVVDYEDLANSESVQFLSKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLSVRQIEYLNRTYKV
NVPFILMNSFNTNDDTAAIIKKYEGHNVDILTFNQSRYPRILKDSLLPVPKDFKSSIAEWYPPGHGDVFESLYNS
GILEKLLARGIEIIFLSNVDNLGAVVDLRILQHMIETKAEYIMELTNKTKADVKGGTIIDYEGSVRLLEIAQVPK
EHVNEFKSIKKFKYFNTNNIWLNLHAIKRVVENSELEMEIIPNGKTIPGDKKGESDVSIIQLETAVGAAIRHFTN
AHGVNVPRRRFLPVKTCSDLMLVKSDLYTLKHGQLQMSAARFGDAPLIKLGSDFKKVSDFQKRIPSIPKVLELDH
LTITGAVNLGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRLLEH*
Coding >Ophun1|2513
ATGGCGCCTTCGATAATCAATGGACTGACTGTCCCCCAAAAGGCTTTCGAAAACACGTCGACCAACGTGGCCGCT
GCTCAGATGCGCAATGCCTTGACCAACCTCGCCGAGACGGTCGAGGATCCTCAGCAGAAGAAACTGTTTCAGACC
GAAATGGACAACTTCTTCGCCCTCTTCCGCCGATACCTCAACGACAAGGCCGAGGGAAATGCCGTCAACTGGGAT
CGCATCGCTCCGCCCGCGCAGGGCCAGGTGGTCGACTACGAGGACCTCGCCAACTCGGAGTCGGTCCAGTTCCTC
AGCAAGCTCGCGGTGCTCAAGCTCAACGGCGGGCTGGGCACGTCGATGGGCTGCGTGGGGCCCAAGTCGGTCATC
GAGGTGCGCGACGGCATGTCGTTCCTGGATCTGTCGGTGCGGCAGATTGAGTACCTCAACCGCACGTACAAGGTC
AACGTGCCCTTTATCCTGATGAACTCGTTCAACACAAACGACGACACGGCGGCCATTATCAAAAAGTACGAGGGC
CACAACGTCGACATCTTGACCTTTAACCAGTCTCGCTACCCGCGCATCCTCAAGGACTCGCTGCTCCCGGTGCCC
AAGGACTTCAAGTCGTCCATCGCCGAGTGGTACCCGCCCGGGCACGGCGACGTGTTCGAGTCGCTCTACAACTCG
GGCATCCTGGAGAAGCTGCTGGCGCGCGGCATCGAAATCATCTTTCTGTCCAACGTGGACAACCTGGGCGCCGTG
GTGGACCTGAGGATCCTGCAGCACATGATTGAGACCAAGGCCGAGTACATCATGGAGCTGACCAACAAGACAAAG
GCCGACGTCAAGGGCGGCACCATTATCGACTACGAGGGCTCGGTGCGGCTGCTGGAGATTGCGCAGGTGCCCAAG
GAGCACGTCAACGAGTTCAAGTCGATCAAGAAGTTCAAGTACTTCAACACCAACAACATCTGGCTCAACCTGCAC
GCCATCAAGCGGGTGGTGGAGAATAGCGAGTTGGAGATGGAGATTATCCCCAACGGCAAGACGATACCGGGCGAC
AAGAAGGGAGAGTCGGACGTGTCCATCATCCAGCTGGAGACGGCGGTGGGGGCGGCGATCCGGCACTTTACCAAC
GCGCACGGGGTCAACGTGCCGCGGCGGCGCTTCCTGCCGGTCAAGACGTGCTCGGATCTGATGCTGGTCAAGTCG
GACCTGTACACGCTCAAGCACGGGCAGCTGCAGATGAGCGCGGCTCGGTTCGGGGACGCGCCGCTCATCAAGCTG
GGCAGCGACTTCAAGAAGGTGTCGGACTTTCAGAAGCGCATCCCGTCGATCCCCAAGGTGCTGGAGCTGGACCAC
CTGACGATTACGGGGGCCGTCAACCTGGGGCGGGGGGTGACGTTGAAGGGGACCGTCATTATTGTGGCGACGGAG
GGGAGCACGATTGACATTCCGCCGGGGTCCATCCTGGAGAATGTGGTGGTGCAGGGAAGCCTGCGTCTGTTGGAG
CACTAG
Transcript >Ophun1|2513
ATGGCGCCTTCGATAATCAATGGACTGACTGTCCCCCAAAAGGCTTTCGAAAACACGTCGACCAACGTGGCCGCT
GCTCAGATGCGCAATGCCTTGACCAACCTCGCCGAGACGGTCGAGGATCCTCAGCAGAAGAAACTGTTTCAGACC
GAAATGGACAACTTCTTCGCCCTCTTCCGCCGATACCTCAACGACAAGGCCGAGGGAAATGCCGTCAACTGGGAT
CGCATCGCTCCGCCCGCGCAGGGCCAGGTGGTCGACTACGAGGACCTCGCCAACTCGGAGTCGGTCCAGTTCCTC
AGCAAGCTCGCGGTGCTCAAGCTCAACGGCGGGCTGGGCACGTCGATGGGCTGCGTGGGGCCCAAGTCGGTCATC
GAGGTGCGCGACGGCATGTCGTTCCTGGATCTGTCGGTGCGGCAGATTGAGTACCTCAACCGCACGTACAAGGTC
AACGTGCCCTTTATCCTGATGAACTCGTTCAACACAAACGACGACACGGCGGCCATTATCAAAAAGTACGAGGGC
CACAACGTCGACATCTTGACCTTTAACCAGTCTCGCTACCCGCGCATCCTCAAGGACTCGCTGCTCCCGGTGCCC
AAGGACTTCAAGTCGTCCATCGCCGAGTGGTACCCGCCCGGGCACGGCGACGTGTTCGAGTCGCTCTACAACTCG
GGCATCCTGGAGAAGCTGCTGGCGCGCGGCATCGAAATCATCTTTCTGTCCAACGTGGACAACCTGGGCGCCGTG
GTGGACCTGAGGATCCTGCAGCACATGATTGAGACCAAGGCCGAGTACATCATGGAGCTGACCAACAAGACAAAG
GCCGACGTCAAGGGCGGCACCATTATCGACTACGAGGGCTCGGTGCGGCTGCTGGAGATTGCGCAGGTGCCCAAG
GAGCACGTCAACGAGTTCAAGTCGATCAAGAAGTTCAAGTACTTCAACACCAACAACATCTGGCTCAACCTGCAC
GCCATCAAGCGGGTGGTGGAGAATAGCGAGTTGGAGATGGAGATTATCCCCAACGGCAAGACGATACCGGGCGAC
AAGAAGGGAGAGTCGGACGTGTCCATCATCCAGCTGGAGACGGCGGTGGGGGCGGCGATCCGGCACTTTACCAAC
GCGCACGGGGTCAACGTGCCGCGGCGGCGCTTCCTGCCGGTCAAGACGTGCTCGGATCTGATGCTGGTCAAGTCG
GACCTGTACACGCTCAAGCACGGGCAGCTGCAGATGAGCGCGGCTCGGTTCGGGGACGCGCCGCTCATCAAGCTG
GGCAGCGACTTCAAGAAGGTGTCGGACTTTCAGAAGCGCATCCCGTCGATCCCCAAGGTGCTGGAGCTGGACCAC
CTGACGATTACGGGGGCCGTCAACCTGGGGCGGGGGGTGACGTTGAAGGGGACCGTCATTATTGTGGCGACGGAG
GGGAGCACGATTGACATTCCGCCGGGGTCCATCCTGGAGAATGTGGTGGTGCAGGGAAGCCTGCGTCTGTTGGAG
CACTAG
Gene >Ophun1|2513
ATGGCGCCTTCGATAATCAATGGACTGACTGTCCCCCAAAAGGCTTTCGAAAACACGTCGACCAACGTGGCCGCT
GCTCAGATGCGCAATGCCTTGACCAACCTCGCCGAGACGGTCGAGGATCCTCAGCAGAAGAAAGTATGTCGGGAC
GAGGGAAAGATGGCAATTCCATCGTGGCCATTCGCTAATGCTGCGTCACGAAAAGCTGTTTCAGACCGAAATGGA
CAACTTCTTCGCCCTCTTCCGCCGATACCTCAACGACAAGGCCGAGGGAAATGCCGTGTAGGTTTCGCCTGACTC
CGGGATGGATACACAATGGGAGGGAGGCTCACGGCAGCTGCAGCAACTGGGATCGCATCGCTCCGCCCGCGCAGG
GCCAGGTGGTCGACTACGAGGACCTCGCCAACTCGGAGTCGGTCCAGTTCCTCAGCAAGCTCGCGGTGCTCAAGC
TCAACGGCGGGCTGGGCACGTCGATGGGCTGCGTGGGGCCCAAGTCGGTCATCGAGGTGCGCGACGGCATGTCGT
TCCTGGATCTGTCGGTGCGGCAGATTGAGTACCTCAACCGCACGTACAAGGTCAACGTGCCCTTTATCCTGATGA
ACTCGTTCAACACAAACGACGACACGGCGGCCATTATCAAAAAGTACGAGGGCCACAACGTCGACATCTTGACCT
TTAACCAGTCTCGCTACCCGCGCATCCTCAAGGACTCGCTGCTCCCGGTGCCCAAGGACTTCAAGTCGTCCATCG
CCGAGTGGTACCCGCCCGGGCACGGCGACGTGTTCGAGTCGCTCTACAACTCGGGCATCCTGGAGAAGCTGCTGG
CGCGCGGCATCGAAATCATCTTTCTGTCCAACGTGGACAACCTGGGCGCCGTGGTGGACCTGAGGATCCTGCAGC
ACATGATTGAGACCAAGGCCGAGTACATCATGGAGCTGACCAACAAGACAAAGGCCGACGTCAAGGGCGGCACCA
TTATCGACTACGAGGGCTCGGTGCGGCTGCTGGAGATTGCGCAGGTGCCCAAGGAGCACGTCAACGAGTTCAAGT
CGATCAAGAAGTTCAAGTACTTCAACACCAACAACATCTGGCTCAACCTGCACGCCATCAAGCGGGTGGTGGAGA
ATAGCGAGTTGGAGATGGAGATTATCCCCAACGGCAAGACGATACCGGGCGACAAGAAGGGAGAGTCGGACGTGT
CCATCATCCAGCTGGAGACGGCGGTGGGGGCGGCGATCCGGCACTTTACCAACGCGCACGGGGTCAACGTGCCGC
GGCGGCGCTTCCTGCCGGTCAAGACGTGCTCGGATCTGATGCTGGTCAAGTCGGACCTGTACACGCTCAAGCACG
GGCAGCTGCAGATGAGCGCGGCTCGGTTCGGGGACGCGCCGCTCATCAAGCTGGGCAGCGACTTCAAGAAGGTGT
CGGACTTTCAGAAGCGCATCCCGTCGATCCCCAAGGTGCTGGAGCTGGACCACCTGACGATTACGGGGGCCGTCA
ACCTGGGGCGGGGGGTGACGTTGAAGGGGACCGTCATTATTGTGGCGACGGAGGGGAGCACGATTGACATTCCGC
CGGGGTCCATCCTGGAGAATGTGGTGGTGCAGGGAAGCCTGCGTCTGTTGGAGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail