Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2509
Gene name
LocationContig_226:13106..14719
Strand-
Gene length (bp)1613
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 9.0E-05 73 328

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0050789 regulation of biological process No
GO:0004888 transmembrane signaling receptor activity No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0038023 signaling receptor activity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0060089 molecular transducer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 74 96 22
2 109 131 22
3 151 170 19
4 191 213 22
5 233 255 22
6 302 324 22
7 367 389 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2509
MGTLAVANLCPHPFLDSRLFGDDGCKQDPDRIWMVLTSGTDVEGRLCQTISADVKCCLPCPMADWVYPDSFRTIT
AVANWVAAVSGICCVVLLVSWAALPVDKTSRHYLSVCFTFGVLLMNLGFIVPLAAQPDQCFDKITPHDMRSSKVC
GASGTLLILGGWCGVMWSFLRSFSLHLQICWQVIVGRNFMVFAQIAGWGVPVVAIIVALVFSGVSFRFGATCHIN
HPNSLADLWIPLLVFAAATVVITFATFGYCVKVYLAALSDNSTSTQRSGLAPYSNSLRTMTPRQAYRRVRRVVAL
QWRGIAIVLIIIADVIFFSIVFVFQDHIVRSVTQDPRVARAWTLCLIAASGEKDKCLDEARSLVVNQATVSAVLL
LLALNGIWLLFLLGRWSMLSGWVELVKTVSNSRKKEFVSVDARFEINKKPRTYEMLSKDSSAVASPVSAVVSPLA
KSPTTDYFGQQSVRYHAPSQSYSSPRPPPRSPVASSGHEGDMNPLGMNHV*
Coding >Ophun1|2509
ATGGGCACCCTCGCCGTGGCCAACCTCTGTCCCCACCCGTTCTTGGACTCGAGGCTGTTCGGTGACGACGGCTGT
AAGCAAGATCCGGATCGGATCTGGATGGTGCTGACAAGTGGCACAGATGTCGAAGGCCGGCTCTGTCAGACCATC
TCGGCCGATGTCAAATGCTGTCTTCCCTGTCCAATGGCCGACTGGGTCTACCCGGACAGCTTCCGGACGATAACG
GCCGTGGCCAACTGGGTGGCTGCCGTCAGCGGCATCTGCTGCGTGGTGCTGCTGGTATCGTGGGCGGCGCTGCCC
GTCGATAAGACGAGCCGCCACTACCTCAGCGTGTGCTTTACCTTTGGCGTGCTGCTGATGAATCTCGGCTTCATC
GTACCGCTGGCCGCCCAGCCGGACCAATGCTTCGACAAGATTACGCCTCACGACATGCGCAGCAGCAAGGTGTGC
GGCGCCTCGGGCACCCTCCTGATACTCGGGGGCTGGTGTGGCGTCATGTGGTCGTTCCTCCGGTCCTTTTCCCTG
CATCTCCAGATATGCTGGCAGGTCATCGTCGGACGCAACTTTATGGTGTTTGCCCAGATAGCCGGCTGGGGCGTT
CCCGTCGTCGCCATCATCGTCGCCCTCGTCTTCAGCGGCGTCTCGTTCCGGTTCGGCGCGACGTGTCACATAAAC
CACCCCAATAGCCTGGCGGATCTCTGGATCCCGCTGCTCGTCTTCGCCGCTGCCACCGTCGTCATCACCTTTGCC
ACCTTTGGCTACTGCGTCAAGGTCTACCTGGCCGCCCTGTCGGACAACTCGACGTCGACACAGCGGTCCGGCCTG
GCGCCCTACAGCAACAGCCTGCGTACCATGACGCCGCGCCAGGCCTACCGCCGCGTACGCCGGGTGGTGGCGCTG
CAGTGGCGCGGTATCGCAATCGTTCTCATCATCATCGCCGACGTCATCTTCTTCTCCATCGTCTTCGTCTTTCAG
GATCACATCGTCCGTTCCGTCACTCAGGACCCAAGGGTGGCTAGGGCCTGGACCTTGTGTCTGATTGCCGCGTCG
GGCGAAAAGGATAAGTGTCTGGACGAGGCGAGATCCTTGGTCGTCAACCAGGCGACCGTCTCGGCCGTCTTGTTG
CTTCTCGCGCTCAATGGCATCTGGCTCCTCTTCCTCCTGGGCCGATGGTCGATGTTGTCGGGATGGGTTGAGCTC
GTCAAGACGGTGTCCAACAGCAGGAAGAAGGAGTTTGTCTCGGTGGACGCTCGGTTCGAGATCAACAAGAAGCCG
CGGACGTACGAGATGCTGTCCAAGGACTCGAGCGCGGTGGCGTCGCCGGTATCGGCCGTGGTATCGCCGCTGGCC
AAGTCGCCGACGACGGATTACTTTGGACAGCAGTCGGTACGCTATCACGCGCCATCGCAGTCGTACTCGAGTCCG
CGGCCACCGCCGAGGTCACCGGTTGCGTCGAGCGGACACGAGGGAGACATGAACCCGCTAGGGATGAACCACGTA
TAG
Transcript >Ophun1|2509
ATGGGCACCCTCGCCGTGGCCAACCTCTGTCCCCACCCGTTCTTGGACTCGAGGCTGTTCGGTGACGACGGCTGT
AAGCAAGATCCGGATCGGATCTGGATGGTGCTGACAAGTGGCACAGATGTCGAAGGCCGGCTCTGTCAGACCATC
TCGGCCGATGTCAAATGCTGTCTTCCCTGTCCAATGGCCGACTGGGTCTACCCGGACAGCTTCCGGACGATAACG
GCCGTGGCCAACTGGGTGGCTGCCGTCAGCGGCATCTGCTGCGTGGTGCTGCTGGTATCGTGGGCGGCGCTGCCC
GTCGATAAGACGAGCCGCCACTACCTCAGCGTGTGCTTTACCTTTGGCGTGCTGCTGATGAATCTCGGCTTCATC
GTACCGCTGGCCGCCCAGCCGGACCAATGCTTCGACAAGATTACGCCTCACGACATGCGCAGCAGCAAGGTGTGC
GGCGCCTCGGGCACCCTCCTGATACTCGGGGGCTGGTGTGGCGTCATGTGGTCGTTCCTCCGGTCCTTTTCCCTG
CATCTCCAGATATGCTGGCAGGTCATCGTCGGACGCAACTTTATGGTGTTTGCCCAGATAGCCGGCTGGGGCGTT
CCCGTCGTCGCCATCATCGTCGCCCTCGTCTTCAGCGGCGTCTCGTTCCGGTTCGGCGCGACGTGTCACATAAAC
CACCCCAATAGCCTGGCGGATCTCTGGATCCCGCTGCTCGTCTTCGCCGCTGCCACCGTCGTCATCACCTTTGCC
ACCTTTGGCTACTGCGTCAAGGTCTACCTGGCCGCCCTGTCGGACAACTCGACGTCGACACAGCGGTCCGGCCTG
GCGCCCTACAGCAACAGCCTGCGTACCATGACGCCGCGCCAGGCCTACCGCCGCGTACGCCGGGTGGTGGCGCTG
CAGTGGCGCGGTATCGCAATCGTTCTCATCATCATCGCCGACGTCATCTTCTTCTCCATCGTCTTCGTCTTTCAG
GATCACATCGTCCGTTCCGTCACTCAGGACCCAAGGGTGGCTAGGGCCTGGACCTTGTGTCTGATTGCCGCGTCG
GGCGAAAAGGATAAGTGTCTGGACGAGGCGAGATCCTTGGTCGTCAACCAGGCGACCGTCTCGGCCGTCTTGTTG
CTTCTCGCGCTCAATGGCATCTGGCTCCTCTTCCTCCTGGGCCGATGGTCGATGTTGTCGGGATGGGTTGAGCTC
GTCAAGACGGTGTCCAACAGCAGGAAGAAGGAGTTTGTCTCGGTGGACGCTCGGTTCGAGATCAACAAGAAGCCG
CGGACGTACGAGATGCTGTCCAAGGACTCGAGCGCGGTGGCGTCGCCGGTATCGGCCGTGGTATCGCCGCTGGCC
AAGTCGCCGACGACGGATTACTTTGGACAGCAGTCGGTACGCTATCACGCGCCATCGCAGTCGTACTCGAGTCCG
CGGCCACCGCCGAGGTCACCGGTTGCGTCGAGCGGACACGAGGGAGACATGAACCCGCTAGGGATGAACCACGTA
TAG
Gene >Ophun1|2509
ATGGGCACCCTCGCCGTGGCCAACCTCTGTCCCCACCCGTTCTTGGACTCGAGGCTGTTCGGTGACGACGGCTGT
AAGCAAGATCCGGATCGGATCTGGATGGTGCTGACAAGTGGCACAGATGTCGAAGGCCGGCTCTGTCAGACCATC
TCGGCCGATGTCAAATGCTGTCTTCCCTGTCCAATGGCCGACTGGGTCTACCCGGACAGCTTCCGGACGATAACG
GCCGTGGCCAACTGGGTGGCTGCCGTCAGCGGCATCTGCTGCGTGGTGCTGCTGGTATCGTGGGCGGCGCTGCCC
GTCGATAAGACGAGCCGCCACTACCTCAGCGTGTGCTTTACCTTTGGCGTGCTGCTGATGAATGTGAGTCGACGG
CGTTCATATGCAGATGTTTGGACATGGCAGCTGACGGTTCAGCTCGGCTTCATCGTACCGCTGGCCGCCCAGCCG
GACCAATGCTTCGACAAGATTACGCCTCACGACATGCGCAGCAGCAAGGTGTGCGGCGCCTCGGGCACCCTCCTG
ATACTCGGGGGCTGGTGTGGCGTCATGTGGTCGTTCCTCCGGTCCTTTTCCCTGCATCTCCAGATATGCTGGCAG
GTCATCGTCGGACGCAACTTTATGGTGTTTGCCCAGATAGCCGGCTGGGGCGTTCCCGTCGTCGCCATCATCGTC
GCCCTCGTCTTCAGCGGCGTCTCGTTCCGGTTCGGCGCGACGTGTCACATAAACCACCCCAATAGCCTGGCGGAT
CTCTGGATCCCGCTGCTCGTCTTCGCCGCTGCCACCGTCGTCATCACCTTTGCCACCTTTGGCTACTGCGTCAAG
GTCTACCTGGCCGCCCTGTCGGACAACTCGACGTCGACACAGCGGTCCGGCCTGGCGCCCTACAGCAACAGCCTG
CGTACCATGACGCCGCGCCAGGCCTACCGCCGCGTACGCCGGGTGGTGGCGCTGCAGTGGCGCGGTATCGCAATC
GTTCTCATCATCATCGCCGACGTCATCTTCTTCTCCATCGTCTTCGTCTTTCAGGATCACATCGTCCGTTCCGTC
ACTCAGGACCCAAGGGTGGCTAGGGCCTGGACCTTGTGTCTGATTGCCGCGTCGGGCGAAAAGGATAAGTGTCTG
GACGAGGCGAGATCCTTGGTCGTCAACCAGGCGACCGTCTCGGCCGTCTTGTTGCTTCTCGCGGTATGTTGATGC
CCGTACGTCGACAAAGGTGCTGCGGCTGACGAATGCCTCGACAGCTCAATGGCATCTGGCTCCTCTTCCTCCTGG
GCCGATGGTCGATGTTGTCGGGATGGGTTGAGCTCGTCAAGACGGTGTCCAACAGCAGGAAGAAGGAGTTTGTCT
CGGTGGACGCTCGGTTCGAGATCAACAAGAAGCCGCGGACGTACGAGATGCTGTCCAAGGACTCGAGCGCGGTGG
CGTCGCCGGTATCGGCCGTGGTATCGCCGCTGGCCAAGTCGCCGACGACGGATTACTTTGGACAGCAGTCGGTAC
GCTATCACGCGCCATCGCAGTCGTACTCGAGTCCGCGGCCACCGCCGAGGTCACCGGTTGCGTCGAGCGGACACG
AGGGAGACATGAACCCGCTAGGGATGAACCACGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail