Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2500
Gene name
LocationContig_225:19554..20639
Strand+
Gene length (bp)1085
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 4.7E-21 188 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14142|SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sym1 PE=3 SV=1 37 254 6.0E-50
sp|Q10244|YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.14 PE=3 SV=1 43 253 2.0E-36
sp|Q08743|YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR292C PE=1 SV=1 22 253 5.0E-31
sp|Q4WDZ0|SYM1_ASPFU Protein sym1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sym1 PE=3 SV=1 51 251 3.0E-26
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 45 252 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14142|SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sym1 PE=3 SV=1 37 254 6.0E-50
sp|Q10244|YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.14 PE=3 SV=1 43 253 2.0E-36
sp|Q08743|YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR292C PE=1 SV=1 22 253 5.0E-31
sp|Q4WDZ0|SYM1_ASPFU Protein sym1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sym1 PE=3 SV=1 51 251 3.0E-26
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 45 252 2.0E-23
sp|Q7SCY7|SYM1_NEUCR Protein sym-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sym-1 PE=3 SV=2 45 252 6.0E-21
sp|Q6BMY0|SYM1_DEBHA Protein SYM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SYM1 PE=3 SV=1 38 248 8.0E-21
sp|Q59Q43|SYM1_CANAL Protein SYM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SYM1 PE=3 SV=1 44 248 1.0E-20
sp|Q754F0|SYM1_ASHGO Protein SYM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SYM1 PE=3 SV=1 143 254 1.0E-20
sp|Q6CIY7|SYM1_KLULA Protein SYM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SYM1 PE=3 SV=1 104 254 1.0E-18
sp|Q6FXJ3|SYM1_CANGA Protein SYM1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SYM1 PE=3 SV=1 40 253 2.0E-18
sp|P0CQ39|SYM1_CRYNB Protein SYM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYM1 PE=3 SV=1 38 254 3.0E-18
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 43 253 3.0E-18
sp|P0CQ38|SYM1_CRYNJ Protein SYM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYM1 PE=3 SV=1 38 254 3.0E-18
sp|Q2TXA2|SYM1_ASPOR Protein sym1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sym1 PE=3 SV=1 45 254 5.0E-18
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 104 248 2.0E-17
sp|Q06563|SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYM1 PE=1 SV=1 111 253 5.0E-17
sp|Q6CAW5|SYM1_YARLI Protein SYM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYM1 PE=3 SV=1 106 253 2.0E-16
sp|A5D787|M17L2_BOVIN Mpv17-like protein 2 OS=Bos taurus GN=MPV17L2 PE=2 SV=1 122 248 3.0E-16
sp|Q4P9K6|SYM1_USTMA Protein SYM1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SYM1 PE=3 SV=1 123 254 3.0E-16
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 35 249 7.0E-16
sp|Q567V2|M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens GN=MPV17L2 PE=1 SV=2 122 248 1.0E-15
sp|Q6DIY8|M17L2_XENTR Mpv17-like protein 2 OS=Xenopus tropicalis GN=mpv17l2 PE=2 SV=1 102 248 1.0E-15
sp|Q5BK62|MPV17_RAT Protein Mpv17 OS=Rattus norvegicus GN=Mpv17 PE=2 SV=1 132 248 3.0E-15
sp|Q6DGV7|M17L2_DANRE Mpv17-like protein 2 OS=Danio rerio GN=mpv17l2 PE=2 SV=1 123 248 8.0E-15
sp|P19258|MPV17_MOUSE Protein Mpv17 OS=Mus musculus GN=Mpv17 PE=1 SV=1 132 248 8.0E-15
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 129 248 2.0E-14
sp|Q2KIN6|MPV17_BOVIN Protein Mpv17 OS=Bos taurus GN=MPV17 PE=2 SV=1 132 248 2.0E-14
sp|P39210|MPV17_HUMAN Protein Mpv17 OS=Homo sapiens GN=MPV17 PE=1 SV=1 132 248 2.0E-14
sp|Q8VIK2|M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus GN=Mpv17l2 PE=1 SV=1 134 248 5.0E-14
sp|Q68F62|MP17L_XENLA Mpv17-like protein OS=Xenopus laevis GN=mpv17l PE=2 SV=1 115 248 8.0E-14
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 123 249 2.0E-13
sp|Q60SZ2|MPV17_CAEBR Mpv17-like protein (Fragment) OS=Caenorhabditis briggsae GN=CBG20693 PE=3 SV=2 45 249 5.0E-12
sp|Q2QL34|MP17L_HUMAN Mpv17-like protein OS=Homo sapiens GN=MPV17L PE=1 SV=1 138 253 6.0E-12
sp|Q54XX9|PX24B_DICDI PXMP2/4 family protein 2 OS=Dictyostelium discoideum GN=DDB_G0278529 PE=3 SV=1 50 248 9.0E-12
sp|P42925|PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus GN=Pxmp2 PE=1 SV=2 127 248 1.0E-11
sp|Q99MS3|MP17L_MOUSE Mpv17-like protein OS=Mus musculus GN=Mpv17l PE=1 SV=2 121 253 3.0E-11
sp|Q5TZ51|MPV17_DANRE Protein Mpv17 OS=Danio rerio GN=mpv17 PE=2 SV=1 135 248 3.0E-11
sp|Q07066|PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus GN=Pxmp2 PE=1 SV=2 127 248 1.0E-10
sp|Q2KIK2|MP17L_BOVIN Mpv17-like protein OS=Bos taurus GN=MPV17L PE=2 SV=1 121 251 1.0E-10
sp|Q9NR77|PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens GN=PXMP2 PE=1 SV=3 129 248 2.0E-08
sp|Q7YWV6|MPV17_CAEEL Mpv17-like protein OS=Caenorhabditis elegans GN=T18D3.9 PE=3 SV=1 110 248 1.0E-07
sp|Q54ZX5|PX24A_DICDI PXMP2/4 family protein 1 OS=Dictyostelium discoideum GN=DDB_G0277335 PE=3 SV=1 37 254 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 75 22
3 167 189 22
4 228 250 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2500
MSWELSWRRFWRSLNSQYIYGRVPLVHAIVFLIEMGLIARLTARFNAQYEERPLITMMITNAILGGIADTVAQGI
SAVRLRTAAKAGVKDEAFNMEIPEIGRQGTFLERDLLPESKALPPPFDWERLTRFAGYGFCVAPLQFKWFRFLER
AFPMTKTSAFAPAMKRVVFDQFVYAPFGVGLFFVAMTVAEGGGKRAVSNKLRDMYVPTLKANYVVWPAVQMVNFR
LMPVQFQLPFVSTIGIAWTAYLSLTNASS*
Coding >Ophun1|2500
ATGTCGTGGGAGCTGTCGTGGCGGCGCTTCTGGCGCTCCCTCAACAGCCAGTATATTTATGGTCGTGTCCCGCTG
GTGCATGCTATAGTCTTCCTCATCGAAATGGGTCTCATTGCGCGCCTGACGGCTCGGTTCAATGCCCAGTACGAA
GAACGACCGCTAATCACCATGATGATCACCAACGCCATTCTCGGCGGCATAGCCGACACCGTCGCCCAGGGCATC
TCCGCCGTCCGCCTGCGCACCGCCGCCAAAGCAGGCGTCAAAGACGAAGCCTTCAACATGGAGATCCCCGAGATC
GGTCGTCAAGGCACTTTCCTCGAACGCGACTTGCTGCCCGAATCCAAGGCGCTGCCACCGCCCTTTGACTGGGAG
CGGCTGACGCGCTTCGCCGGCTATGGCTTCTGCGTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCTCGAACGG
GCCTTTCCCATGACCAAGACGAGTGCTTTCGCCCCAGCTATGAAGCGCGTCGTCTTCGATCAGTTCGTATACGCA
CCTTTCGGTGTCGGTCTCTTCTTTGTCGCCATGACGGTCGCCGAGGGAGGCGGCAAGCGTGCCGTTAGCAACAAG
CTGAGGGACATGTACGTCCCGACGCTCAAAGCCAACTACGTCGTCTGGCCCGCCGTTCAGATGGTAAACTTTCGT
CTGATGCCGGTGCAGTTCCAGCTGCCCTTCGTCTCGACCATCGGTATCGCCTGGACAGCCTACCTCTCCCTCACC
AACGCATCTTCCTAA
Transcript >Ophun1|2500
ATGTCGTGGGAGCTGTCGTGGCGGCGCTTCTGGCGCTCCCTCAACAGCCAGTATATTTATGGTCGTGTCCCGCTG
GTGCATGCTATAGTCTTCCTCATCGAAATGGGTCTCATTGCGCGCCTGACGGCTCGGTTCAATGCCCAGTACGAA
GAACGACCGCTAATCACCATGATGATCACCAACGCCATTCTCGGCGGCATAGCCGACACCGTCGCCCAGGGCATC
TCCGCCGTCCGCCTGCGCACCGCCGCCAAAGCAGGCGTCAAAGACGAAGCCTTCAACATGGAGATCCCCGAGATC
GGTCGTCAAGGCACTTTCCTCGAACGCGACTTGCTGCCCGAATCCAAGGCGCTGCCACCGCCCTTTGACTGGGAG
CGGCTGACGCGCTTCGCCGGCTATGGCTTCTGCGTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCTCGAACGG
GCCTTTCCCATGACCAAGACGAGTGCTTTCGCCCCAGCTATGAAGCGCGTCGTCTTCGATCAGTTCGTATACGCA
CCTTTCGGTGTCGGTCTCTTCTTTGTCGCCATGACGGTCGCCGAGGGAGGCGGCAAGCGTGCCGTTAGCAACAAG
CTGAGGGACATGTACGTCCCGACGCTCAAAGCCAACTACGTCGTCTGGCCCGCCGTTCAGATGGTAAACTTTCGT
CTGATGCCGGTGCAGTTCCAGCTGCCCTTCGTCTCGACCATCGGTATCGCCTGGACAGCCTACCTCTCCCTCACC
AACGCATCTTCCTAA
Gene >Ophun1|2500
ATGTCGTGGGAGCTGTCGTGGCGGCGCTTCTGGCGCTCCCTCAACAGCCAGTATATTTATGGTCGTGTCGTACGT
GTTGTCCTCAGTTGCTCCACTAGCCTTCTCTCCTGATTACGTCGTCGCTTTTTTTTTCCTTTTTCCTTGTCTTTG
CCGTGACACTTGCCAACGTCGCATCCTCGGGCTTCCACTGACGACACGTACCTACAGCCGCTGGTGCATGCTATA
GTCTTCCTCATCGAAATGGGTCTCATTGCGCGCCTGACGGCTCGGTTCAATGCCCAGTACGAAGAACGACCGCGT
ATGTTCCCAACTACCGCTCCATCATTGCTGCCTGCGAGGCCATCATTGCCCCTTTACCTCGCCAGCGACAGGAAC
CCGTTCCACAGCGACGCATTCGAAGAGCTTAACTGACTCTTGTTATCCACAGTAATCACCATGATGATCACCAAC
GCCATTCTCGGCGGCATAGCCGACACCGTCGCCCAGGGCATCTCCGCCGTCCGCCTGCGCACCGCCGCCAAAGCA
GGCGTCAAAGACGAAGCCTTCAACATGGAGATCCCCGAGATCGGTCGTCAAGGCACTTTCCTCGAACGCGACTTG
CTGCCCGAATCCAAGGCGCTGCCACCGCCCTTTGACTGGGAGCGGCTGACGCGCTTCGCCGGCTATGGCTTCTGC
GTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCTCGAACGGGCCTTTCCCATGACCAAGACGAGTGCTTTCGCC
CCAGCTATGAAGCGCGTCGTCTTCGATCAGTTCGTATACGCACCTTTCGGTGTCGGTCTCTTCTTTGTCGCCATG
ACGGTCGCCGAGGGAGGCGGCAAGCGTGCCGTTAGCAACAAGCTGAGGGACATGTACGTCCCGACGCTCAAAGCC
AACTACGTCGTCTGGCCCGCCGTTCAGATGGTAAACTTTCGTCTGATGCCGGTGCAGTTCCAGCTGGTATGTCGT
CATCTCTAAGACGTCTGGCTTGTGACTATGCTAACGCAGAACAGCCCTTCGTCTCGACCATCGGTATCGCCTGGA
CAGCCTACCTCTCCCTCACCAACGCATCTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail