Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|250
Gene name
LocationContig_106:9528..11122
Strand-
Gene length (bp)1594
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06420 Mgm101p Mitochondrial genome maintenance MGM101 2.3E-81 154 324

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00970|MG101_KLULA Mitochondrial genome maintenance protein MGM101 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MGM101 PE=3 SV=2 147 324 3.0E-66
sp|Q4P4Y2|MG101_USTMA Mitochondrial genome maintenance protein MGM101 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MGM101 PE=3 SV=1 155 324 1.0E-63
sp|P32787|MG101_YEAST Mitochondrial genome maintenance protein MGM101 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGM101 PE=1 SV=1 151 324 4.0E-62
sp|Q6FK91|MG101_CANGA Mitochondrial genome maintenance protein MGM101 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MGM101 PE=3 SV=1 144 324 2.0E-61
sp|Q6C6V8|MG101_YARLI Mitochondrial genome maintenance protein MGM101 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MGM101 PE=3 SV=1 152 324 4.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00970|MG101_KLULA Mitochondrial genome maintenance protein MGM101 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MGM101 PE=3 SV=2 147 324 3.0E-66
sp|Q4P4Y2|MG101_USTMA Mitochondrial genome maintenance protein MGM101 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MGM101 PE=3 SV=1 155 324 1.0E-63
sp|P32787|MG101_YEAST Mitochondrial genome maintenance protein MGM101 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGM101 PE=1 SV=1 151 324 4.0E-62
sp|Q6FK91|MG101_CANGA Mitochondrial genome maintenance protein MGM101 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MGM101 PE=3 SV=1 144 324 2.0E-61
sp|Q6C6V8|MG101_YARLI Mitochondrial genome maintenance protein MGM101 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MGM101 PE=3 SV=1 152 324 4.0E-61
sp|Q5AI97|MG101_CANAL Mitochondrial genome maintenance protein MGM101 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MGM101 PE=3 SV=1 143 325 3.0E-60
sp|Q75DV9|MG101_ASHGO Mitochondrial genome maintenance protein MGM101 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MGM101 PE=3 SV=1 143 324 4.0E-60
sp|O14354|MG101_SCHPO Mitochondrial genome maintenance protein mgm101 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mgm101 PE=3 SV=2 151 304 4.0E-58
sp|Q6BN05|MG101_DEBHA Mitochondrial genome maintenance protein MGM101 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MGM101 PE=3 SV=2 153 324 2.0E-56
sp|Q8MYF0|MG101_DICDI Mitochondrial genome maintenance protein mgm101 homolog OS=Dictyostelium discoideum GN=mgm101 PE=3 SV=1 159 323 1.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0003697 single-stranded DNA binding Yes
GO:0000262 mitochondrial chromosome Yes
GO:0000002 mitochondrial genome maintenance Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0043229 intracellular organelle No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0007005 mitochondrion organization No
GO:0006950 response to stress No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003677 DNA binding No
GO:0005694 chromosome No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0043228 non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2802
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7537
Ophiocordyceps australis map64 (Brazil) OphauB2|6977
Ophiocordyceps camponoti-floridani Ophcf2|01095
Ophiocordyceps camponoti-rufipedis Ophun1|250 (this protein)
Ophiocordyceps kimflemingae Ophio5|6853
Ophiocordyceps subramaniannii Hirsu2|4492

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|250
MIEGVEVMGYSRRLPTEIFNNLTKASTLTTTPKEPHQMDKKPDTHAQEQPEDDEPDEWDKRIFSTGCAEENAKLT
DCYFDKKDWRACTAETSDGMRRSFVFPGVRDGISPPPRRNSLPLYLSTSSSTGHTVAAAVPPRWTTELEADSASA
ADVNWASSFHGVATKPVTEEQFQVLMRPLPESDIEVKPDGVIYLPEIKYRRRLNEAFGPMGWGLIPKGDAVVGQS
IVTREYALIVNGRFVSQAQGENPFFSPDQLPSAVEGCKSNALMRCCKDLGIGSELWDPKYVRHFRKNNMEEVWVE
HAISKKKRTFWYRKGAVDVAYPYKIAVNSRST*
Coding >Ophun1|250
ATGATCGAGGGAGTTGAGGTCATGGGCTATAGCCGACGATTACCAACCGAAATCTTCAACAACCTGACTAAAGCT
TCTACCCTCACCACCACCCCCAAAGAACCGCATCAGATGGACAAGAAACCAGATACGCACGCGCAAGAGCAGCCA
GAAGATGACGAGCCGGACGAGTGGGACAAGCGCATCTTCAGCACCGGCTGCGCAGAGGAAAACGCCAAGCTGACG
GACTGCTATTTCGATAAGAAGGACTGGAGGGCCTGCACCGCCGAGACCTCGGACGGGATGCGACGGAGCTTCGTT
TTTCCTGGCGTTCGCGACGGCATCTCGCCTCCGCCTCGGCGCAACAGCCTGCCGCTCTACCTCAGCACCTCAAGC
AGCACCGGCCATACTGTCGCCGCGGCCGTCCCTCCGCGGTGGACGACGGAATTGGAAGCCGATTCGGCGTCGGCG
GCTGATGTCAATTGGGCCAGCAGCTTTCATGGCGTGGCGACGAAGCCCGTGACGGAGGAGCAGTTTCAGGTGCTG
ATGAGGCCCTTGCCTGAATCTGATATCGAGGTCAAGCCCGATGGTGTCATTTACCTACCCGAGATCAAGTATCGT
CGGCGGTTGAACGAGGCTTTTGGACCCATGGGATGGGGCCTGATACCCAAGGGCGATGCCGTCGTCGGCCAGAGC
ATCGTGACGCGCGAGTACGCGCTCATCGTCAACGGCCGCTTCGTCTCCCAAGCACAGGGCGAGAACCCCTTCTTC
AGCCCCGATCAGCTACCCTCCGCCGTCGAGGGCTGCAAGTCCAACGCCCTGATGCGCTGCTGCAAGGACCTCGGC
ATCGGCTCCGAGCTCTGGGATCCCAAATACGTCCGCCATTTCCGGAAGAACAATATGGAGGAGGTATGGGTCGAG
CATGCAATTTCCAAGAAGAAGCGCACCTTTTGGTATCGCAAGGGCGCCGTCGACGTCGCGTATCCTTACAAGATT
GCTGTCAACTCGAGGAGCACCTGA
Transcript >Ophun1|250
ATGATCGAGGGAGTTGAGGTCATGGGCTATAGCCGACGATTACCAACCGAAATCTTCAACAACCTGACTAAAGCT
TCTACCCTCACCACCACCCCCAAAGAACCGCATCAGATGGACAAGAAACCAGATACGCACGCGCAAGAGCAGCCA
GAAGATGACGAGCCGGACGAGTGGGACAAGCGCATCTTCAGCACCGGCTGCGCAGAGGAAAACGCCAAGCTGACG
GACTGCTATTTCGATAAGAAGGACTGGAGGGCCTGCACCGCCGAGACCTCGGACGGGATGCGACGGAGCTTCGTT
TTTCCTGGCGTTCGCGACGGCATCTCGCCTCCGCCTCGGCGCAACAGCCTGCCGCTCTACCTCAGCACCTCAAGC
AGCACCGGCCATACTGTCGCCGCGGCCGTCCCTCCGCGGTGGACGACGGAATTGGAAGCCGATTCGGCGTCGGCG
GCTGATGTCAATTGGGCCAGCAGCTTTCATGGCGTGGCGACGAAGCCCGTGACGGAGGAGCAGTTTCAGGTGCTG
ATGAGGCCCTTGCCTGAATCTGATATCGAGGTCAAGCCCGATGGTGTCATTTACCTACCCGAGATCAAGTATCGT
CGGCGGTTGAACGAGGCTTTTGGACCCATGGGATGGGGCCTGATACCCAAGGGCGATGCCGTCGTCGGCCAGAGC
ATCGTGACGCGCGAGTACGCGCTCATCGTCAACGGCCGCTTCGTCTCCCAAGCACAGGGCGAGAACCCCTTCTTC
AGCCCCGATCAGCTACCCTCCGCCGTCGAGGGCTGCAAGTCCAACGCCCTGATGCGCTGCTGCAAGGACCTCGGC
ATCGGCTCCGAGCTCTGGGATCCCAAATACGTCCGCCATTTCCGGAAGAACAATATGGAGGAGGTATGGGTCGAG
CATGCAATTTCCAAGAAGAAGCGCACCTTTTGGTATCGCAAGGGCGCCGTCGACGTCGCGTATCCTTACAAGATT
GCTGTCAACTCGAGGAGCACCTGA
Gene >Ophun1|250
ATGATCGAGGGAGTTGAGGTCATGGGCTATAGCCGACGATTACCAACCGAAATCTTCAACAACCTGACTAAAGCT
TCTACCCTCACCACCACCCCCAAAGAACCGCATCAGATGGACAAGAAACCAGATACGCACGCGCAAGAGCAGCCA
GAAGATGACGAGCCGGACGAGTGGTGCGTGAAACCTCTCAGCTCTTCCCCTCGTCGACACGGTGCTGATCAGCTG
CCACTCTCAGGGACAAGCGCATCTTCAGCACCGGCTGCGCAGGTGACAATCACTCCGCCTCGGCCCCATCCCTGA
CGACACCCTTCTTTCATCTCCAGCTGACGAGCAGCGCGCGCAGAGGAAAACGCCAAGCTGACGGACTGCTATTTC
GATAAGAAGGACTGGAGGGCCTGCACCGCCGAGGTCGGCGTCCCTTTCCCTCCCTTGATTGAGTAGCAGCAGCCA
TGACGATTGAAACTGACGGTCCGATAGATGGAGAGCTTCAAGCAGTGCTGGCAACGACAGGGCAACGATGAGCGC
ACTGGAAGCCGGTCGTGATGCTGGGCGCGGGAAAGCTCAAGCACATCGGCCTACCCTAGACCTCGGACGGGATGC
GACGGAGCTTCGTTTTTCCTGGTCTGAAATTTGGTACCGATTATCAGGGACTCTGAGCAAAAAAGGAGCTATAGC
AAAAGAGCAAGTGTCATCGCACCCCCATCCTCTCGTTCCTCTCCCCATCCTCTCCTGATCGTTGCGAGCCATGTC
CGTCTTCCGCCAGGCGTTCGCGACGGCATCTCGCCTCCGCCTCGGCGCAACAGCCTGCCGCTCTACCTCAGCACC
TCAAGCAGCACCGGCCATACTGTCGCCGCGGGTGATGCGCAGGGCATTGTCGTCAGAGGCATCGGATCCGCCGCC
GCAATACCAACCAGCCGTCCCTCCGCGGTGGACGACGGAATTGGAAGCCGATTCGGCGTCGGCGGCTGATGTCAA
TTGGGCCAGCAGCTTTCATGGCGTGGCGACGAAGCCCGTGACGGAGGAGCAGTTTCAGGTGCTGATGAGGCCCTT
GCCTGAATCTGATATCGAGGTCAAGCCCGATGGTGTCATTTACCTACCCGAGATCAAGTATCGTCGGCGGTTGAA
CGAGGCTTTTGGACCCATGGGATGGGGCCTGATACCCAAGGGCGATGCCGTCGTCGGCCAGAGCATCGTGACGCG
CGAGTACGCGCTCATCGTCAACGGCCGGTAAGCCCCTCTCCCCATCTACCAACCCAAGTCTTGCGTCTCGATGAC
ATCCGCTGACCCCGTTGCTTGTTCCGCTGCCAGCTTCGTCTCCCAAGCACAGGGCGAGAACCCCTTCTTCAGCCC
CGATCAGCTACCCTCCGCCGTCGAGGGCTGCAAGTCCAACGCCCTGATGCGCTGCTGCAAGGACCTCGGCATCGG
CTCCGAGCTCTGGGATCCCAAATACGTCCGCCATTTCCGGAAGAACAATATGGAGGAGGTATGGGTCGAGCATGC
AATTTCCAAGAAGAAGCGCACCTTTTGGTATCGCAAGGGCGCCGTCGACGTCGCGTATCCTTACAAGATTGCTGT
CAACTCGAGGAGCACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail