Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|25
Gene name
LocationContig_1:62225..62834
Strand+
Gene length (bp)609
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport 4.5E-10 55 168

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USM9|COQ10_SCHPO Coenzyme Q-binding protein coq10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq10 PE=3 SV=1 44 188 1.0E-13
sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 43 194 7.0E-10
sp|Q9ZDZ7|RATA_RICPR Ribosome association toxin RatA OS=Rickettsia prowazekii (strain Madrid E) GN=ratA PE=3 SV=1 45 199 9.0E-09
sp|Q75CC1|COQ10_ASHGO Coenzyme Q-binding protein COQ10, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COQ10 PE=3 SV=1 8 200 7.0E-08
sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 46 198 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|25
MPPRILQLRRPQLILRHRPSSLPLIQHRLLLNLDAEGPPRHCTASRRLPFAAMPLYEIIVDIDSYKEFLTGCSQS
AVTRWTEPDAHGRRWPDEAILTLGFRSISETFTSKLKCCPGVLIETVAGPGEQETGSRALISSLRTRWTLQPTSR
GPNVETEVRVDIDYRMRHIASDFLIASYVPQVLEAVVKLFERRAYEKLRETS*
Coding >Ophun1|25
ATGCCGCCGCGAATACTGCAGCTGCGGCGACCGCAGCTCATTCTGCGCCATCGTCCCTCTTCCTTGCCTCTCATC
CAGCACCGTCTTCTTCTAAACCTCGATGCCGAAGGCCCTCCGCGTCACTGCACCGCCAGTCGCAGGCTGCCGTTC
GCAGCCATGCCGCTCTATGAAATCATCGTCGACATCGACTCTTACAAAGAATTCCTCACTGGATGTTCACAATCC
GCAGTCACCCGTTGGACTGAACCGGATGCTCACGGACGCCGTTGGCCTGACGAGGCGATACTGACCCTTGGCTTC
AGGAGCATATCAGAGACGTTTACCAGCAAGCTGAAGTGCTGTCCGGGCGTTCTCATCGAAACCGTCGCCGGCCCT
GGCGAACAGGAAACCGGCTCTAGAGCTCTCATCAGTTCCCTCCGAACCCGCTGGACTCTGCAGCCTACCTCGCGG
GGGCCCAATGTCGAGACTGAAGTCCGCGTCGACATCGACTACCGAATGAGACACATTGCATCCGATTTTCTCATC
GCCAGCTATGTGCCCCAGGTTCTCGAGGCCGTGGTCAAACTCTTCGAGAGGCGAGCCTACGAGAAGCTGAGAGAG
ACGAGCTAA
Transcript >Ophun1|25
ATGCCGCCGCGAATACTGCAGCTGCGGCGACCGCAGCTCATTCTGCGCCATCGTCCCTCTTCCTTGCCTCTCATC
CAGCACCGTCTTCTTCTAAACCTCGATGCCGAAGGCCCTCCGCGTCACTGCACCGCCAGTCGCAGGCTGCCGTTC
GCAGCCATGCCGCTCTATGAAATCATCGTCGACATCGACTCTTACAAAGAATTCCTCACTGGATGTTCACAATCC
GCAGTCACCCGTTGGACTGAACCGGATGCTCACGGACGCCGTTGGCCTGACGAGGCGATACTGACCCTTGGCTTC
AGGAGCATATCAGAGACGTTTACCAGCAAGCTGAAGTGCTGTCCGGGCGTTCTCATCGAAACCGTCGCCGGCCCT
GGCGAACAGGAAACCGGCTCTAGAGCTCTCATCAGTTCCCTCCGAACCCGCTGGACTCTGCAGCCTACCTCGCGG
GGGCCCAATGTCGAGACTGAAGTCCGCGTCGACATCGACTACCGAATGAGACACATTGCATCCGATTTTCTCATC
GCCAGCTATGTGCCCCAGGTTCTCGAGGCCGTGGTCAAACTCTTCGAGAGGCGAGCCTACGAGAAGCTGAGAGAG
ACGAGCTAA
Gene >Ophun1|25
ATGCCGCCGCGAATACTGCAGCTGCGGCGACCGCAGCTCATTCTGCGCCATCGTCCCTCTTCCTTGCCTCTCATC
CAGCACCGTCTTCTTCTAAACCTCGATGCCGAAGGCCCTCCGCGTCACTGCACCGCCAGTCGCAGGCTGCCGTTC
GCAGCCATGCCGCTCTATGAAATCATCGTCGACATCGACTCTTACAAAGAATTCCTCACTGGATGTTCACAATCC
GCAGTCACCCGTTGGACTGAACCGGATGCTCACGGACGCCGTTGGCCTGACGAGGCGATACTGACCCTTGGCTTC
AGGAGCATATCAGAGACGTTTACCAGCAAGCTGAAGTGCTGTCCGGGCGTTCTCATCGAAACCGTCGCCGGCCCT
GGCGAACAGGAAACCGGCTCTAGAGCTCTCATCAGTTCCCTCCGAACCCGCTGGACTCTGCAGCCTACCTCGCGG
GGGCCCAATGTCGAGACTGAAGTCCGCGTCGACATCGACTACCGAATGAGACACATTGCATCCGATTTTCTCATC
GCCAGCTATGTGCCCCAGGTTCTCGAGGCCGTGGTCAAACTCTTCGAGAGGCGAGCCTACGAGAAGCTGAGAGAG
ACGAGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail