Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2477
Gene name
LocationContig_223:21295..24815
Strand+
Gene length (bp)3520
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.7E-17 164 366
PF12838 Fer4_7 4Fe-4S dicluster domain 1.2E-11 690 744
PF00037 Fer4 4Fe-4S binding domain 1.8E-04 688 707
PF00037 Fer4 4Fe-4S binding domain 3.1E-07 724 745
PF13187 Fer4_9 4Fe-4S dicluster domain 6.6E-07 690 745
PF13237 Fer4_10 4Fe-4S dicluster domain 1.7E-05 688 741

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12644|NDUS8_NEUCR NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo21.3c PE=2 SV=1 603 790 1.0E-110
sp|P80269|NDUS8_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Solanum tuberosum PE=1 SV=2 564 790 1.0E-83
sp|P0CB97|NDUS8_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii GN=NDUFS8 PE=2 SV=1 630 790 3.0E-83
sp|Q60HE3|NDUS8_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis GN=NDUFS8 PE=2 SV=1 630 790 4.0E-83
sp|Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus GN=Ndufs8 PE=1 SV=1 630 790 4.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12644|NDUS8_NEUCR NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo21.3c PE=2 SV=1 603 790 1.0E-110
sp|P80269|NDUS8_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Solanum tuberosum PE=1 SV=2 564 790 1.0E-83
sp|P0CB97|NDUS8_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii GN=NDUFS8 PE=2 SV=1 630 790 3.0E-83
sp|Q60HE3|NDUS8_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis GN=NDUFS8 PE=2 SV=1 630 790 4.0E-83
sp|Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus GN=Ndufs8 PE=1 SV=1 630 790 4.0E-83
sp|P42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus GN=NDUFS8 PE=1 SV=1 630 790 6.0E-83
sp|P0CB98|NDUS8_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo pygmaeus GN=NDUFS8 PE=2 SV=1 630 790 1.0E-82
sp|Q0MQI3|NDUS8_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pan troglodytes GN=NDUFS8 PE=2 SV=1 630 790 1.0E-82
sp|O00217|NDUS8_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens GN=NDUFS8 PE=1 SV=1 630 790 1.0E-82
sp|Q42599|NDS8A_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana GN=At1g79010 PE=2 SV=1 564 790 5.0E-82
sp|Q0MQI2|NDUS8_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS8 PE=2 SV=1 630 790 5.0E-82
sp|Q9FX83|NDS8B_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial OS=Arabidopsis thaliana GN=At1g16700 PE=2 SV=1 630 790 2.0E-81
sp|Q5LPS9|NUOI_RUEPO NADH-quinone oxidoreductase subunit I OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoI PE=3 SV=1 634 790 2.0E-81
sp|Q2G5Z4|NUOI_NOVAD NADH-quinone oxidoreductase subunit I OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoI PE=3 SV=1 631 790 4.0E-81
sp|Q0BSL0|NUOI_GRABC NADH-quinone oxidoreductase subunit I OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoI PE=3 SV=1 632 790 3.0E-80
sp|O24143|NDUS8_TOBAC NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 564 790 1.0E-79
sp|Q1GIM9|NUOI_RUEST NADH-quinone oxidoreductase subunit I OS=Ruegeria sp. (strain TM1040) GN=nuoI PE=3 SV=1 634 790 1.0E-79
sp|A8LIV0|NUOI_DINSH NADH-quinone oxidoreductase subunit I OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoI PE=3 SV=1 634 790 2.0E-79
sp|A8I407|NUOI_AZOC5 NADH-quinone oxidoreductase subunit I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoI PE=3 SV=1 632 790 2.0E-79
sp|Q28T58|NUOI_JANSC NADH-quinone oxidoreductase subunit I OS=Jannaschia sp. (strain CCS1) GN=nuoI PE=3 SV=1 634 790 3.0E-79
sp|Q3J3F0|NUOI1_RHOS4 NADH-quinone oxidoreductase subunit I 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoI1 PE=3 SV=1 634 790 1.0E-78
sp|A3PIX9|NUOI1_RHOS1 NADH-quinone oxidoreductase subunit I 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoI1 PE=3 SV=1 634 790 1.0E-78
sp|P29921|NQO9_PARDE NADH-quinone oxidoreductase subunit 9 OS=Paracoccus denitrificans GN=nqo9 PE=3 SV=1 634 790 1.0E-78
sp|A1B486|NUOI_PARDP NADH-quinone oxidoreductase subunit I OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoI PE=1 SV=1 634 790 2.0E-78
sp|Q2W3J2|NUOI_MAGSA NADH-quinone oxidoreductase subunit I OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoI PE=3 SV=1 630 790 3.0E-78
sp|O21233|NDUS8_RECAM NADH-ubiquinone oxidoreductase subunit 8 OS=Reclinomonas americana GN=NAD8 PE=3 SV=1 630 790 4.0E-78
sp|Q2NA74|NUOI_ERYLH NADH-quinone oxidoreductase subunit I OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoI PE=3 SV=1 630 790 5.0E-78
sp|A7IP99|NUOI_XANP2 NADH-quinone oxidoreductase subunit I OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoI PE=3 SV=1 632 790 6.0E-78
sp|Q22619|NDUS8_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Caenorhabditis elegans GN=T20H4.5 PE=2 SV=1 611 790 7.0E-78
sp|P42031|NUOI_RHOCA NADH-quinone oxidoreductase subunit I OS=Rhodobacter capsulatus GN=nuoI PE=3 SV=1 634 790 1.0E-77
sp|B6ISX3|NUOI_RHOCS NADH-quinone oxidoreductase subunit I OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoI PE=3 SV=1 632 790 3.0E-77
sp|Q163R7|NUOI_ROSDO NADH-quinone oxidoreductase subunit I OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoI PE=3 SV=1 634 790 4.0E-77
sp|Q1GTK7|NUOI_SPHAL NADH-quinone oxidoreductase subunit I OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoI PE=3 SV=1 630 790 2.0E-76
sp|Q73GH4|NUOI_WOLPM NADH-quinone oxidoreductase subunit I OS=Wolbachia pipientis wMel GN=nuoI PE=3 SV=1 632 789 1.0E-75
sp|Q4FM83|NUOI_PELUB NADH-quinone oxidoreductase subunit I OS=Pelagibacter ubique (strain HTCC1062) GN=nuoI PE=3 SV=1 632 790 2.0E-75
sp|Q2RU32|NUOI_RHORT NADH-quinone oxidoreductase subunit I OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoI PE=3 SV=1 641 790 6.0E-75
sp|Q2GJS3|NUOI_ANAPZ NADH-quinone oxidoreductase subunit I OS=Anaplasma phagocytophilum (strain HZ) GN=nuoI PE=3 SV=1 640 789 8.0E-75
sp|B1LUM8|NUOI_METRJ NADH-quinone oxidoreductase subunit I OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoI PE=3 SV=1 632 790 9.0E-75
sp|C3PLS5|NUOI_RICAE NADH-quinone oxidoreductase subunit I OS=Rickettsia africae (strain ESF-5) GN=nuoI PE=3 SV=1 637 790 2.0E-74
sp|Q1QL93|NUOI_NITHX NADH-quinone oxidoreductase subunit I OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoI PE=3 SV=1 631 790 2.0E-74
sp|Q98KR4|NUOI_RHILO NADH-quinone oxidoreductase subunit I OS=Rhizobium loti (strain MAFF303099) GN=nuoI PE=3 SV=1 630 790 2.0E-74
sp|A9W1M5|NUOI_METEP NADH-quinone oxidoreductase subunit I OS=Methylobacterium extorquens (strain PA1) GN=nuoI PE=3 SV=1 632 790 3.0E-74
sp|B7KQ58|NUOI_METC4 NADH-quinone oxidoreductase subunit I OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=nuoI PE=3 SV=1 632 790 3.0E-74
sp|Q89KJ6|NUOI_BRADU NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoI PE=3 SV=1 632 790 3.0E-74
sp|A6X1M5|NUOI_OCHA4 NADH-quinone oxidoreductase subunit I OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoI PE=3 SV=1 630 790 3.0E-74
sp|Q135Y4|NUOI2_RHOPS NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoI2 PE=3 SV=1 632 790 4.0E-74
sp|Q92G94|NUOI_RICCN NADH-quinone oxidoreductase subunit I OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoI PE=3 SV=1 637 790 4.0E-74
sp|Q11JJ8|NUOI_CHESB NADH-quinone oxidoreductase subunit I OS=Chelativorans sp. (strain BNC1) GN=nuoI PE=3 SV=1 630 790 5.0E-74
sp|Q6N5N2|NUOI1_RHOPA NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoI1 PE=3 SV=1 636 790 5.0E-74
sp|Q3SRF2|NUOI_NITWN NADH-quinone oxidoreductase subunit I OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoI PE=3 SV=1 631 790 6.0E-74
sp|Q5PAK7|NUOI_ANAMM NADH-quinone oxidoreductase subunit I OS=Anaplasma marginale (strain St. Maries) GN=nuoI PE=3 SV=1 646 789 7.0E-74
sp|B1ZA38|NUOI_METPB NADH-quinone oxidoreductase subunit I OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoI PE=3 SV=1 632 790 7.0E-74
sp|C4K221|NUOI_RICPU NADH-quinone oxidoreductase subunit I OS=Rickettsia peacockii (strain Rustic) GN=nuoI PE=3 SV=1 637 790 8.0E-74
sp|Q5GSG5|NUOI_WOLTR NADH-quinone oxidoreductase subunit I OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoI PE=3 SV=1 632 789 8.0E-74
sp|B0CLD7|NUOI_BRUSI NADH-quinone oxidoreductase subunit I OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoI PE=3 SV=1 630 790 9.0E-74
sp|Q2IWX5|NUOI2_RHOP2 NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoI2 PE=3 SV=1 632 790 9.0E-74
sp|A5VPZ1|NUOI_BRUO2 NADH-quinone oxidoreductase subunit I OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|C0RIE7|NUOI_BRUMB NADH-quinone oxidoreductase subunit I OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|Q57DU3|NUOI_BRUAB NADH-quinone oxidoreductase subunit I OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|Q2YNF5|NUOI_BRUA2 NADH-quinone oxidoreductase subunit I OS=Brucella abortus (strain 2308) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|B2S551|NUOI_BRUA1 NADH-quinone oxidoreductase subunit I OS=Brucella abortus (strain S19) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|Q9ZCF8|NUOI_RICPR NADH-quinone oxidoreductase subunit I OS=Rickettsia prowazekii (strain Madrid E) GN=nuoI PE=3 SV=1 637 790 1.0E-73
sp|B3CUK1|NUOI_ORITI NADH-quinone oxidoreductase subunit I OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoI PE=3 SV=1 637 790 1.0E-73
sp|A5CFN6|NUOI_ORITB NADH-quinone oxidoreductase subunit I OS=Orientia tsutsugamushi (strain Boryong) GN=nuoI PE=3 SV=1 637 790 1.0E-73
sp|Q8G1A9|NUOI_BRUSU NADH-quinone oxidoreductase subunit I OS=Brucella suis biovar 1 (strain 1330) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|A9MAI7|NUOI_BRUC2 NADH-quinone oxidoreductase subunit I OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoI PE=3 SV=1 630 790 1.0E-73
sp|A8GTS0|NUOI_RICRS NADH-quinone oxidoreductase subunit I OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoI PE=3 SV=1 637 790 1.0E-73
sp|B0BVB0|NUOI_RICRO NADH-quinone oxidoreductase subunit I OS=Rickettsia rickettsii (strain Iowa) GN=nuoI PE=3 SV=1 637 790 1.0E-73
sp|Q4UK24|NUOI_RICFE NADH-quinone oxidoreductase subunit I OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoI PE=3 SV=1 637 790 2.0E-73
sp|Q8YGK8|NUOI_BRUME NADH-quinone oxidoreductase subunit I OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoI PE=3 SV=1 630 790 2.0E-73
sp|Q215H2|NUOI1_RHOPB NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoI1 PE=3 SV=1 636 790 2.0E-73
sp|B8IUV4|NUOI_METNO NADH-quinone oxidoreductase subunit I OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=nuoI PE=3 SV=1 632 790 2.0E-73
sp|Q07NL5|NUOI2_RHOP5 NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoI2 PE=3 SV=1 636 790 3.0E-73
sp|Q92QP4|NUOI1_RHIME NADH-quinone oxidoreductase subunit I 1 OS=Rhizobium meliloti (strain 1021) GN=nuoI1 PE=3 SV=1 640 790 5.0E-73
sp|Q0C1D6|NUOI_HYPNA NADH-quinone oxidoreductase subunit I OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoI PE=3 SV=1 640 790 5.0E-73
sp|Q8UFW9|NUOI_AGRFC NADH-quinone oxidoreductase subunit I OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoI PE=3 SV=1 630 790 6.0E-73
sp|Q68VV4|NUOI_RICTY NADH-quinone oxidoreductase subunit I OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoI PE=3 SV=1 637 790 7.0E-73
sp|Q3YSA1|NUOI_EHRCJ NADH-quinone oxidoreductase subunit I OS=Ehrlichia canis (strain Jake) GN=nuoI PE=3 SV=1 646 789 7.0E-73
sp|A4YVK2|NUOI_BRASO NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium sp. (strain ORS278) GN=nuoI PE=3 SV=1 636 790 8.0E-73
sp|A8F2T4|NUOI_RICM5 NADH-quinone oxidoreductase subunit I OS=Rickettsia massiliae (strain Mtu5) GN=nuoI PE=3 SV=2 637 790 9.0E-73
sp|B5ZYM2|NUOI_RHILW NADH-quinone oxidoreductase subunit I OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoI PE=3 SV=1 643 790 1.0E-72
sp|B0ULL2|NUOI_METS4 NADH-quinone oxidoreductase subunit I OS=Methylobacterium sp. (strain 4-46) GN=nuoI PE=3 SV=1 632 790 1.0E-72
sp|Q6G396|NUOI_BARHE NADH-quinone oxidoreductase subunit I OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoI PE=3 SV=1 632 790 1.0E-72
sp|A7HY41|NUOI_PARL1 NADH-quinone oxidoreductase subunit I OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoI PE=3 SV=1 632 790 2.0E-72
sp|Q6FZY3|NUOI_BARQU NADH-quinone oxidoreductase subunit I OS=Bartonella quintana (strain Toulouse) GN=nuoI PE=3 SV=1 630 790 2.0E-72
sp|A8GPY5|NUOI_RICAH NADH-quinone oxidoreductase subunit I OS=Rickettsia akari (strain Hartford) GN=nuoI PE=3 SV=1 637 790 2.0E-72
sp|B6JH51|NUOI_OLICO NADH-quinone oxidoreductase subunit I OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoI PE=3 SV=1 639 790 3.0E-72
sp|Q1RKD0|NUOI_RICBR NADH-quinone oxidoreductase subunit I OS=Rickettsia bellii (strain RML369-C) GN=nuoI PE=3 SV=1 637 790 3.0E-72
sp|A8GY32|NUOI_RICB8 NADH-quinone oxidoreductase subunit I OS=Rickettsia bellii (strain OSU 85-389) GN=nuoI PE=3 SV=1 637 790 3.0E-72
sp|Q2GGD7|NUOI_EHRCR NADH-quinone oxidoreductase subunit I OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoI PE=3 SV=1 646 789 3.0E-72
sp|Q0APY2|NUOI_MARMM NADH-quinone oxidoreductase subunit I OS=Maricaulis maris (strain MCS10) GN=nuoI PE=3 SV=1 640 790 4.0E-72
sp|A9IUN3|NUOI_BART1 NADH-quinone oxidoreductase subunit I OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoI PE=3 SV=1 636 790 4.0E-72
sp|A1USX5|NUOI_BARBK NADH-quinone oxidoreductase subunit I OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoI PE=3 SV=1 630 790 5.0E-72
sp|A5EK90|NUOI_BRASB NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoI PE=3 SV=1 639 790 5.0E-72
sp|Q2K9S4|NUOI1_RHIEC NADH-quinone oxidoreductase subunit I 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoI1 PE=3 SV=1 639 790 6.0E-72
sp|Q1MIK6|NUOI_RHIL3 NADH-quinone oxidoreductase subunit I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoI PE=3 SV=1 640 790 1.0E-71
sp|B9JVF4|NUOI_AGRVS NADH-quinone oxidoreductase subunit I OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=nuoI PE=3 SV=1 637 790 1.0E-70
sp|B8EIM5|NUOI_METSB NADH-quinone oxidoreductase subunit I OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=nuoI PE=3 SV=1 632 790 2.0E-70
sp|B2IHV8|NUOI_BEII9 NADH-quinone oxidoreductase subunit I OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoI PE=3 SV=1 632 790 2.0E-69
sp|A8EZZ7|NUOI_RICCK NADH-quinone oxidoreductase subunit I OS=Rickettsia canadensis (strain McKiel) GN=nuoI PE=3 SV=1 637 790 3.0E-69
sp|Q9A6Y4|NUOI_CAUCR NADH-quinone oxidoreductase subunit I OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoI PE=3 SV=1 641 790 4.0E-69
sp|Q5HBF8|NUOI_EHRRW NADH-quinone oxidoreductase subunit I OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoI PE=3 SV=1 646 789 1.0E-67
sp|Q5FHN1|NUOI_EHRRG NADH-quinone oxidoreductase subunit I OS=Ehrlichia ruminantium (strain Gardel) GN=nuoI PE=3 SV=1 646 789 1.0E-67
sp|Q2GCV4|NUOI_NEOSM NADH-quinone oxidoreductase subunit I OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoI PE=3 SV=1 641 779 5.0E-64
sp|Q0AHJ2|NUOI_NITEC NADH-quinone oxidoreductase subunit I OS=Nitrosomonas eutropha (strain C91) GN=nuoI PE=3 SV=1 632 790 2.0E-62
sp|Q82TV1|NUOI_NITEU NADH-quinone oxidoreductase subunit I OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoI PE=3 SV=1 637 790 4.0E-62
sp|Q2YA19|NUOI2_NITMU NADH-quinone oxidoreductase subunit I 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoI2 PE=3 SV=1 637 790 6.0E-61
sp|Q2KUZ8|NUOI_BORA1 NADH-quinone oxidoreductase subunit I OS=Bordetella avium (strain 197N) GN=nuoI PE=3 SV=1 639 790 2.0E-60
sp|Q8XXQ9|NUOI_RALSO NADH-quinone oxidoreductase subunit I OS=Ralstonia solanacearum (strain GMI1000) GN=nuoI PE=3 SV=1 639 790 4.0E-60
sp|Q142G5|NUOI_BURXL NADH-quinone oxidoreductase subunit I OS=Burkholderia xenovorans (strain LB400) GN=nuoI PE=3 SV=1 637 790 6.0E-60
sp|A1W4N0|NUOI_ACISJ NADH-quinone oxidoreductase subunit I OS=Acidovorax sp. (strain JS42) GN=nuoI PE=3 SV=1 637 790 6.0E-60
sp|Q7VZP7|NUOI_BORPE NADH-quinone oxidoreductase subunit I OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoI PE=3 SV=1 639 790 7.0E-60
sp|Q7W5B5|NUOI_BORPA NADH-quinone oxidoreductase subunit I OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoI PE=3 SV=2 639 790 7.0E-60
sp|Q7WCU7|NUOI_BORBR NADH-quinone oxidoreductase subunit I OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoI PE=3 SV=1 639 790 7.0E-60
sp|A2SFN4|NUOI_METPP NADH-quinone oxidoreductase subunit I OS=Methylibium petroleiphilum (strain PM1) GN=nuoI PE=3 SV=1 639 790 9.0E-60
sp|Q5P1E2|NUOI_AROAE NADH-quinone oxidoreductase subunit I OS=Aromatoleum aromaticum (strain EbN1) GN=nuoI PE=3 SV=1 633 790 1.0E-59
sp|Q7NZH3|NUOI_CHRVO NADH-quinone oxidoreductase subunit I OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoI PE=3 SV=1 637 790 1.0E-59
sp|A1KRT1|NUOI_NEIMF NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoI PE=3 SV=1 635 790 3.0E-59
sp|Q7DDS1|NUOI_NEIMB NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoI PE=3 SV=1 635 790 3.0E-59
sp|Q9JQM2|NUOI_NEIMA NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoI PE=3 SV=1 635 790 3.0E-59
sp|Q5F623|NUOI_NEIG1 NADH-quinone oxidoreductase subunit I OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoI PE=3 SV=1 635 790 3.0E-59
sp|Q127Y0|NUOI_POLSJ NADH-quinone oxidoreductase subunit I OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoI PE=3 SV=1 639 790 3.0E-59
sp|Q473T5|NUOI_CUPPJ NADH-quinone oxidoreductase subunit I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoI PE=3 SV=1 639 790 3.0E-59
sp|A1VM68|NUOI_POLNA NADH-quinone oxidoreductase subunit I OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoI PE=3 SV=1 639 790 4.0E-59
sp|Q3SJP9|NUOI_THIDA NADH-quinone oxidoreductase subunit I OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoI PE=3 SV=1 635 790 9.0E-59
sp|Q0A783|NUOI_ALKEH NADH-quinone oxidoreductase subunit I OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoI PE=3 SV=1 637 790 2.0E-58
sp|B3R3X5|NUOI_CUPTR NADH-quinone oxidoreductase subunit I OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoI PE=3 SV=1 639 790 2.0E-58
sp|Q0KCS2|NUOI_CUPNH NADH-quinone oxidoreductase subunit I OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoI PE=3 SV=1 639 790 2.0E-58
sp|Q47HG8|NUOI_DECAR NADH-quinone oxidoreductase subunit I OS=Dechloromonas aromatica (strain RCB) GN=nuoI PE=3 SV=1 639 790 4.0E-58
sp|A4JGC2|NUOI_BURVG NADH-quinone oxidoreductase subunit I OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoI PE=3 SV=1 637 790 5.0E-58
sp|A9AFZ5|NUOI_BURM1 NADH-quinone oxidoreductase subunit I OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoI PE=3 SV=1 637 790 9.0E-58
sp|Q0BDD8|NUOI_BURCM NADH-quinone oxidoreductase subunit I OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoI PE=3 SV=1 637 790 9.0E-58
sp|B1YTP9|NUOI_BURA4 NADH-quinone oxidoreductase subunit I OS=Burkholderia ambifaria (strain MC40-6) GN=nuoI PE=3 SV=1 637 790 9.0E-58
sp|Q2SZM7|NUOI_BURTA NADH-quinone oxidoreductase subunit I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoI PE=3 SV=1 630 790 1.0E-57
sp|Q21YB9|NUOI_RHOFT NADH-quinone oxidoreductase subunit I OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoI PE=3 SV=1 639 790 1.0E-57
sp|Q1GZL7|NUOI_METFK NADH-quinone oxidoreductase subunit I OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoI PE=3 SV=1 630 790 1.0E-57
sp|Q31HF2|NUOI_THICR NADH-quinone oxidoreductase subunit I OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoI PE=3 SV=1 637 790 1.0E-57
sp|A0K915|NUOI_BURCH NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain HI2424) GN=nuoI PE=3 SV=1 637 790 2.0E-57
sp|B1JVN3|NUOI_BURCC NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoI PE=3 SV=1 637 790 2.0E-57
sp|Q1BV21|NUOI_BURCA NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoI PE=3 SV=1 637 790 2.0E-57
sp|A1K5B6|NUOI_AZOSB NADH-quinone oxidoreductase subunit I OS=Azoarcus sp. (strain BH72) GN=nuoI PE=3 SV=1 633 790 4.0E-57
sp|Q63VM5|NUOI_BURPS NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain K96243) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|Q3JUA1|NUOI_BURP1 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 1710b) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|A3NTB4|NUOI_BURP0 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 1106a) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|A1V2M4|NUOI_BURMS NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain SAVP1) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|Q62IP3|NUOI_BURMA NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain ATCC 23344) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|A2S451|NUOI_BURM9 NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain NCTC 10229) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|A3MIA9|NUOI_BURM7 NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain NCTC 10247) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|B4E5L4|NUOI_BURCJ NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoI PE=3 SV=1 637 790 5.0E-57
sp|Q39EF3|NUOI_BURL3 NADH-quinone oxidoreductase subunit I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoI PE=3 SV=1 630 790 5.0E-57
sp|A3N7M5|NUOI_BURP6 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 668) GN=nuoI PE=3 SV=1 630 790 6.0E-57
sp|A1WXV9|NUOI_HALHL NADH-quinone oxidoreductase subunit I OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoI PE=3 SV=1 639 790 6.0E-57
sp|Q1LPV5|NUOI_CUPMC NADH-quinone oxidoreductase subunit I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoI PE=3 SV=1 639 790 1.0E-56
sp|A4G636|NUOI_HERAR NADH-quinone oxidoreductase subunit I OS=Herminiimonas arsenicoxydans GN=nuoI PE=3 SV=1 639 790 3.0E-56
sp|Q8P7U0|NUOI_XANCP NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q4UWB0|NUOI_XANC8 NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q2P0W3|NUOI_XANOM NADH-quinone oxidoreductase subunit I OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q5GXU0|NUOI_XANOR NADH-quinone oxidoreductase subunit I OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q3BRN7|NUOI_XANC5 NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q8PJ48|NUOI_XANAC NADH-quinone oxidoreductase subunit I OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoI PE=3 SV=1 656 790 1.0E-55
sp|Q87EP7|NUOI_XYLFT NADH-quinone oxidoreductase subunit I OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoI PE=3 SV=1 652 790 2.0E-55
sp|Q9PGI7|NUOI_XYLFA NADH-quinone oxidoreductase subunit I OS=Xylella fastidiosa (strain 9a5c) GN=nuoI PE=3 SV=1 652 790 2.0E-55
sp|A1WLN6|NUOI_VEREI NADH-quinone oxidoreductase subunit I OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoI PE=3 SV=1 640 790 7.0E-55
sp|Q3J836|NUOI2_NITOC NADH-quinone oxidoreductase subunit I 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoI2 PE=3 SV=1 647 790 4.0E-54
sp|A1TLM4|NUOI_ACIAC NADH-quinone oxidoreductase subunit I OS=Acidovorax citrulli (strain AAC00-1) GN=nuoI PE=3 SV=1 640 775 5.0E-54
sp|B0TWQ2|NUOI_FRAP2 NADH-quinone oxidoreductase subunit I OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoI PE=3 SV=1 637 790 2.0E-53
sp|A0Q8G4|NUOI_FRATN NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoI PE=3 SV=1 637 790 6.0E-53
sp|A7NEK2|NUOI_FRATF NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoI PE=3 SV=1 637 790 6.0E-53
sp|A5IHV5|NUOI_LEGPC NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Corby) GN=nuoI PE=3 SV=1 652 790 9.0E-53
sp|Q5X1B5|NUOI_LEGPA NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Paris) GN=nuoI PE=3 SV=1 652 790 9.0E-53
sp|Q5WT28|NUOI_LEGPL NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Lens) GN=nuoI PE=3 SV=1 652 790 1.0E-52
sp|Q5ZRU6|NUOI_LEGPH NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoI PE=3 SV=1 652 790 1.0E-52
sp|A5CXG5|NUOI_VESOH NADH-quinone oxidoreductase subunit I OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoI PE=3 SV=1 632 790 2.0E-52
sp|A4IW00|NUOI_FRATW NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|Q5NIM7|NUOI_FRATT NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|Q0BK59|NUOI_FRATO NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|B2SEV7|NUOI_FRATM NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|Q2A1F8|NUOI_FRATH NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|Q14K30|NUOI_FRAT1 NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoI PE=3 SV=1 637 790 2.0E-52
sp|Q83BR3|NUOI_COXBU NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoI PE=3 SV=1 632 790 3.0E-52
sp|A9N8W4|NUOI_COXBR NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoI PE=3 SV=1 632 790 3.0E-52
sp|A9KBL3|NUOI_COXBN NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoI PE=3 SV=1 632 790 3.0E-52
sp|A1AVS0|NUOI_RUTMC NADH-quinone oxidoreductase subunit I OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoI PE=3 SV=1 632 790 9.0E-52
sp|A0LDR9|NUOI_MAGMM NADH-quinone oxidoreductase subunit I OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoI PE=3 SV=1 630 790 7.0E-51
sp|Q67P14|NUOI1_SYMTH NADH-quinone oxidoreductase subunit I 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoI1 PE=3 SV=1 644 770 3.0E-32
sp|C1D0H9|NUOI_DEIDV NADH-quinone oxidoreductase subunit I OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=nuoI PE=3 SV=1 643 769 5.0E-31
sp|C4LB38|NUOI_TOLAT NADH-quinone oxidoreductase subunit I OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nuoI PE=3 SV=1 646 778 1.0E-30
sp|Q74GA0|NUOI1_GEOSL NADH-quinone oxidoreductase subunit I 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoI1 PE=3 SV=1 640 769 2.0E-30
sp|Q1IZW5|NUOI_DEIGD NADH-quinone oxidoreductase subunit I OS=Deinococcus geothermalis (strain DSM 11300) GN=nuoI PE=3 SV=1 643 790 2.0E-30
sp|Q9RU95|NUOI_DEIRA NADH-quinone oxidoreductase subunit I OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nuoI PE=3 SV=1 643 790 6.0E-30
sp|Q39QB5|NUOI2_GEOMG NADH-quinone oxidoreductase subunit I 2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoI2 PE=3 SV=1 640 769 1.0E-29
sp|Q2YA98|NUOI1_NITMU NADH-quinone oxidoreductase subunit I 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoI1 PE=3 SV=1 646 772 1.0E-29
sp|Q87ZQ2|NUOI_PSESM NADH-quinone oxidoreductase subunit I OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoI PE=3 SV=1 646 778 2.0E-28
sp|Q6MDQ8|NUOI_PARUW NADH-quinone oxidoreductase subunit I OS=Protochlamydia amoebophila (strain UWE25) GN=nuoI PE=3 SV=2 644 768 3.0E-28
sp|Q4ZRI6|NUOI_PSEU2 NADH-quinone oxidoreductase subunit I OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nuoI PE=3 SV=1 646 778 3.0E-28
sp|Q3J1Q2|NUOI2_RHOS4 NADH-quinone oxidoreductase subunit I 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoI2 PE=3 SV=1 656 777 5.0E-28
sp|A3PKI7|NUOI2_RHOS1 NADH-quinone oxidoreductase subunit I 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoI2 PE=3 SV=1 656 777 5.0E-28
sp|Q48H47|NUOI_PSE14 NADH-quinone oxidoreductase subunit I OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nuoI PE=3 SV=1 646 778 8.0E-28
sp|Q746T4|NUOI2_GEOSL NADH-quinone oxidoreductase subunit I 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoI2 PE=3 SV=1 644 772 8.0E-28
sp|Q8RQ74|NUOI_PSEFL NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens GN=nuoI PE=2 SV=1 646 778 1.0E-27
sp|Q3KA56|NUOI_PSEPF NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens (strain Pf0-1) GN=nuoI PE=3 SV=1 646 778 1.0E-27
sp|Q3JC22|NUOI1_NITOC NADH-quinone oxidoreductase subunit I 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoI1 PE=3 SV=1 646 778 2.0E-27
sp|Q1I7Z3|NUOI_PSEE4 NADH-quinone oxidoreductase subunit I OS=Pseudomonas entomophila (strain L48) GN=nuoI PE=3 SV=1 646 778 2.0E-27
sp|P57259|NUOI_BUCAI NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoI PE=3 SV=1 646 772 3.0E-27
sp|Q608Y4|NUOI_METCA NADH-quinone oxidoreductase subunit I OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoI PE=3 SV=1 641 772 3.0E-27
sp|Q4K9S9|NUOI_PSEF5 NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nuoI PE=3 SV=1 646 778 3.0E-27
sp|Q72GD6|NUOI_THET2 NADH-quinone oxidoreductase subunit I OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoI PE=3 SV=1 641 790 3.0E-27
sp|Q56224|NQO9_THET8 NADH-quinone oxidoreductase subunit 9 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo9 PE=1 SV=1 641 790 3.0E-27
sp|Q88FH0|NUOI_PSEPK NADH-quinone oxidoreductase subunit I OS=Pseudomonas putida (strain KT2440) GN=nuoI PE=3 SV=1 646 778 3.0E-27
sp|B1KJV5|NUOI_SHEWM NADH-quinone oxidoreductase subunit I OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoI PE=3 SV=1 641 772 4.0E-27
sp|B2VIN2|NUOI_ERWT9 NADH-quinone oxidoreductase subunit I OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nuoI PE=3 SV=1 646 778 6.0E-27
sp|Q744Z4|NUOI1_MYCPA NADH-quinone oxidoreductase subunit I 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoI1 PE=3 SV=1 639 781 7.0E-27
sp|B1JGM0|NUOI_YERPY NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|Q669A7|NUOI_YERPS NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|A4TM29|NUOI_YERPP NADH-quinone oxidoreductase subunit I OS=Yersinia pestis (strain Pestoides F) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|Q1CHQ8|NUOI_YERPN NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|A9R6L4|NUOI_YERPG NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|Q7CJ89|NUOI_YERPE NADH-quinone oxidoreductase subunit I OS=Yersinia pestis GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|B2K814|NUOI_YERPB NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|Q1C6B6|NUOI_YERPA NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|A7FGR1|NUOI_YERP3 NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|A4SLN7|NUOI_AERS4 NADH-quinone oxidoreductase subunit I OS=Aeromonas salmonicida (strain A449) GN=nuoI PE=3 SV=1 646 778 8.0E-27
sp|A3PWR3|NUOI_MYCSJ NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain JLS) GN=nuoI PE=3 SV=1 647 770 8.0E-27
sp|Q3A820|NUOI_PELCD NADH-quinone oxidoreductase subunit I OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nuoI PE=3 SV=1 648 772 8.0E-27
sp|Q39ZB4|NUOI1_GEOMG NADH-quinone oxidoreductase subunit I 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoI1 PE=3 SV=2 644 777 8.0E-27
sp|Q1BBQ1|NUOI_MYCSS NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain MCS) GN=nuoI PE=3 SV=1 647 770 1.0E-26
sp|A1UD96|NUOI_MYCSK NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain KMS) GN=nuoI PE=3 SV=1 647 770 1.0E-26
sp|A0QU28|NUOI_MYCS2 NADH-quinone oxidoreductase subunit I OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nuoI PE=3 SV=1 647 770 1.0E-26
sp|Q7MA42|NUOI_WOLSU NADH-quinone oxidoreductase subunit I OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoI PE=3 SV=1 643 781 1.0E-26
sp|B4EZC3|NUOI_PROMH NADH-quinone oxidoreductase subunit I OS=Proteus mirabilis (strain HI4320) GN=nuoI PE=3 SV=1 646 778 2.0E-26
sp|A6H1Q5|NUOI_FLAPJ NADH-quinone oxidoreductase subunit I OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=nuoI PE=3 SV=1 620 769 2.0E-26
sp|Q9I0J4|NUOI_PSEAE NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoI PE=3 SV=1 646 778 2.0E-26
sp|Q02ND6|NUOI_PSEAB NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nuoI PE=3 SV=1 646 778 2.0E-26
sp|B7VAQ8|NUOI_PSEA8 NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain LESB58) GN=nuoI PE=3 SV=1 646 778 2.0E-26
sp|A6V4E1|NUOI_PSEA7 NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain PA7) GN=nuoI PE=3 SV=1 646 778 2.0E-26
sp|B0V894|NUOI_ACIBY NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain AYE) GN=nuoI PE=3 SV=1 644 778 2.0E-26
sp|A3M2Q5|NUOI_ACIBT NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=nuoI PE=3 SV=2 644 778 2.0E-26
sp|B0VU49|NUOI_ACIBS NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain SDF) GN=nuoI PE=3 SV=1 644 778 2.0E-26
sp|B2HU48|NUOI_ACIBC NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain ACICU) GN=nuoI PE=3 SV=1 644 778 2.0E-26
sp|A0KJ60|NUOI_AERHH NADH-quinone oxidoreductase subunit I OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=nuoI PE=3 SV=1 646 778 3.0E-26
sp|Q1IQK4|NUOI2_KORVE NADH-quinone oxidoreductase subunit I 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoI2 PE=3 SV=1 644 770 4.0E-26
sp|A1JLI2|NUOI_YERE8 NADH-quinone oxidoreductase subunit I OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nuoI PE=3 SV=1 646 778 5.0E-26
sp|Q47LF2|NUOI_THEFY NADH-quinone oxidoreductase subunit I OS=Thermobifida fusca (strain YX) GN=nuoI PE=3 SV=1 646 770 5.0E-26
sp|A1T698|NUOI_MYCVP NADH-quinone oxidoreductase subunit I OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=nuoI PE=3 SV=1 647 788 7.0E-26
sp|Q1QST9|NUOI_CHRSD NADH-quinone oxidoreductase subunit I OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nuoI PE=3 SV=1 646 772 7.0E-26
sp|Q8K9Y0|NUOI_BUCAP NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoI PE=3 SV=1 646 778 8.0E-26
sp|A0PR46|NUOI_MYCUA NADH-quinone oxidoreductase subunit I OS=Mycobacterium ulcerans (strain Agy99) GN=nuoI PE=3 SV=1 647 781 9.0E-26
sp|B2HGE0|NUOI_MYCMM NADH-quinone oxidoreductase subunit I OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=nuoI PE=3 SV=1 647 781 9.0E-26
sp|Q7N2J4|NUOI_PHOLL NADH-quinone oxidoreductase subunit I OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nuoI PE=3 SV=1 646 778 9.0E-26
sp|Q6D2S4|NUOI_PECAS NADH-quinone oxidoreductase subunit I OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nuoI PE=3 SV=1 646 778 1.0E-25
sp|B6JNA8|NUOI_HELP2 NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain P12) GN=nuoI PE=3 SV=1 624 773 1.0E-25
sp|Q6FE64|NUOI_ACIAD NADH-quinone oxidoreductase subunit I OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=nuoI PE=3 SV=1 644 778 1.0E-25
sp|Q04W38|NUOI_LEPBJ NADH-quinone oxidoreductase subunit I OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=nuoI PE=3 SV=1 631 769 1.0E-25
sp|Q04XD4|NUOI_LEPBL NADH-quinone oxidoreductase subunit I OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=nuoI PE=3 SV=1 630 769 1.0E-25
sp|P0AFD9|NUOI_SHIFL NADH-quinone oxidoreductase subunit I OS=Shigella flexneri GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q0T2K6|NUOI_SHIF8 NADH-quinone oxidoreductase subunit I OS=Shigella flexneri serotype 5b (strain 8401) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q31YI0|NUOI_SHIBS NADH-quinone oxidoreductase subunit I OS=Shigella boydii serotype 4 (strain Sb227) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q1R9D6|NUOI_ECOUT NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain UTI89 / UPEC) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|P0AFD6|NUOI_ECOLI NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain K12) GN=nuoI PE=1 SV=1 646 778 2.0E-25
sp|P0AFD7|NUOI_ECOL6 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q0TFG5|NUOI_ECOL5 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|A1ADC9|NUOI_ECOK1 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O1:K1 / APEC GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|P0AFD8|NUOI_ECO57 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O157:H7 GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q32DQ8|NUOI_SHIDS NADH-quinone oxidoreductase subunit I OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q7CQ51|NUOI_SALTY NADH-quinone oxidoreductase subunit I OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q8XFD5|NUOI_SALTI NADH-quinone oxidoreductase subunit I OS=Salmonella typhi GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q5PN58|NUOI_SALPA NADH-quinone oxidoreductase subunit I OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q57M35|NUOI_SALCH NADH-quinone oxidoreductase subunit I OS=Salmonella choleraesuis (strain SC-B67) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q3YZS9|NUOI_SHISS NADH-quinone oxidoreductase subunit I OS=Shigella sonnei (strain Ss046) GN=nuoI PE=3 SV=1 646 778 2.0E-25
sp|Q9ZJV9|NUOI_HELPJ NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoI PE=3 SV=1 640 773 3.0E-25
sp|A7MPB5|NUOI_CROS8 NADH-quinone oxidoreductase subunit I OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nuoI PE=3 SV=1 646 778 3.0E-25
sp|A7HZV6|NUOI_CAMHC NADH-quinone oxidoreductase subunit I OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoI PE=3 SV=1 625 768 3.0E-25
sp|B2UV32|NUOI_HELPS NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain Shi470) GN=nuoI PE=3 SV=1 640 773 3.0E-25
sp|O25858|NUOI_HELPY NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoI PE=3 SV=1 637 773 5.0E-25
sp|Q1QD90|NUOI_PSYCK NADH-quinone oxidoreductase subunit I OS=Psychrobacter cryohalolentis (strain K5) GN=nuoI PE=3 SV=1 644 778 5.0E-25
sp|Q4FU57|NUOI_PSYA2 NADH-quinone oxidoreductase subunit I OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nuoI PE=3 SV=1 644 778 5.0E-25
sp|A4TDB3|NUOI_MYCGI NADH-quinone oxidoreductase subunit I OS=Mycobacterium gilvum (strain PYR-GCK) GN=nuoI PE=3 SV=1 647 788 5.0E-25
sp|Q1CRZ3|NUOI_HELPH NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain HPAG1) GN=nuoI PE=3 SV=1 637 773 5.0E-25
sp|Q17Z60|NUOI_HELAH NADH-quinone oxidoreductase subunit I OS=Helicobacter acinonychis (strain Sheeba) GN=nuoI PE=3 SV=1 640 773 6.0E-25
sp|B5Z8R3|NUOI_HELPG NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain G27) GN=nuoI PE=3 SV=1 640 773 6.0E-25
sp|Q057W8|NUOI_BUCCC NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=nuoI PE=3 SV=1 646 772 7.0E-25
sp|Q7VFT0|NUOI_HELHP NADH-quinone oxidoreductase subunit I OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoI PE=3 SV=1 643 772 7.0E-25
sp|Q92YN8|NUOI2_RHIME NADH-quinone oxidoreductase subunit I 2 OS=Rhizobium meliloti (strain 1021) GN=nuoI2 PE=3 SV=1 632 774 8.0E-25
sp|Q8F9N0|NUOI_LEPIN NADH-quinone oxidoreductase subunit I OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=nuoI PE=3 SV=1 639 769 8.0E-25
sp|Q72VZ9|NUOI_LEPIC NADH-quinone oxidoreductase subunit I OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=nuoI PE=3 SV=1 639 769 8.0E-25
sp|A0QJV5|NUOI_MYCA1 NADH-quinone oxidoreductase subunit I OS=Mycobacterium avium (strain 104) GN=nuoI PE=3 SV=1 647 770 8.0E-25
sp|Q73V07|NUOI2_MYCPA NADH-quinone oxidoreductase subunit I 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoI2 PE=3 SV=1 647 770 8.0E-25
sp|B0SRH5|NUOI_LEPBP NADH-quinone oxidoreductase subunit I OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=nuoI PE=3 SV=1 639 769 1.0E-24
sp|B0SHV5|NUOI_LEPBA NADH-quinone oxidoreductase subunit I OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=nuoI PE=3 SV=1 639 769 1.0E-24
sp|A0LRI9|NUOI_ACIC1 NADH-quinone oxidoreductase subunit I OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoI PE=3 SV=1 646 770 1.0E-24
sp|Q8EI36|NUOI_SHEON NADH-quinone oxidoreductase subunit I OS=Shewanella oneidensis (strain MR-1) GN=nuoI PE=3 SV=1 646 778 1.0E-24
sp|Q2NSK6|NUOI_SODGM NADH-quinone oxidoreductase subunit I OS=Sodalis glossinidius (strain morsitans) GN=nuoI PE=3 SV=1 646 778 1.0E-24
sp|Q2JFL2|NUOI_FRASC NADH-quinone oxidoreductase subunit I OS=Frankia sp. (strain CcI3) GN=nuoI PE=3 SV=1 646 770 2.0E-24
sp|Q11VC0|NUOI_CYTH3 NADH-quinone oxidoreductase subunit I OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nuoI PE=3 SV=1 620 769 2.0E-24
sp|A8LC93|NUOI_FRASN NADH-quinone oxidoreductase subunit I OS=Frankia sp. (strain EAN1pec) GN=nuoI PE=3 SV=1 646 770 4.0E-24
sp|C5B8H9|NUOI_EDWI9 NADH-quinone oxidoreductase subunit I OS=Edwardsiella ictaluri (strain 93-146) GN=nuoI PE=3 SV=1 646 778 9.0E-24
sp|Q2J0E6|NUOI1_RHOP2 NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoI1 PE=3 SV=1 654 773 1.0E-23
sp|Q01ZR8|NUOI1_SOLUE NADH-quinone oxidoreductase subunit I 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoI1 PE=3 SV=1 644 769 1.0E-23
sp|A8FNM9|NUOI_CAMJ8 NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoI PE=3 SV=1 620 787 1.0E-23
sp|Q0S442|NUOI_RHOJR NADH-quinone oxidoreductase subunit I OS=Rhodococcus jostii (strain RHA1) GN=nuoI PE=3 SV=1 647 770 1.0E-23
sp|Q13BG8|NUOI1_RHOPS NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoI1 PE=3 SV=1 654 773 1.0E-23
sp|A0LJM3|NUOI2_SYNFM NADH-quinone oxidoreductase subunit I 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoI2 PE=3 SV=1 644 771 2.0E-23
sp|Q6N1Z5|NUOI2_RHOPA NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoI2 PE=3 SV=1 654 773 2.0E-23
sp|Q0RRW0|NUOI_FRAAA NADH-quinone oxidoreductase subunit I OS=Frankia alni (strain ACN14a) GN=nuoI PE=3 SV=1 646 770 2.0E-23
sp|C1AZF5|NUOI_RHOOB NADH-quinone oxidoreductase subunit I OS=Rhodococcus opacus (strain B4) GN=nuoI PE=3 SV=1 647 770 2.0E-23
sp|Q5YWD4|NUOHI_NOCFA NADH-quinone oxidoreductase subunits H/I OS=Nocardia farcinica (strain IFM 10152) GN=nuoH/I PE=3 SV=1 656 770 2.0E-23
sp|Q30PI7|NUOI_SULDN NADH-quinone oxidoreductase subunit I OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoI PE=3 SV=1 643 768 2.0E-23
sp|C1AGS0|NUOI_MYCBT NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=nuoI PE=3 SV=1 647 781 5.0E-23
sp|A1KNE9|NUOI_MYCBP NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nuoI PE=3 SV=1 647 781 5.0E-23
sp|Q7TX57|NUOI_MYCBO NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoI PE=3 SV=1 647 781 5.0E-23
sp|P9WJG9|NUOI_MYCTU NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoI PE=1 SV=1 647 781 5.0E-23
sp|P9WJG8|NUOI_MYCTO NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoI PE=3 SV=1 647 781 5.0E-23
sp|A5U7G9|NUOI_MYCTA NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nuoI PE=3 SV=1 647 781 5.0E-23
sp|Q82DX3|NUOI1_STRAW NADH-quinone oxidoreductase subunit I 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoI1 PE=3 SV=1 647 773 6.0E-23
sp|A1SE35|NUOI_NOCSJ NADH-quinone oxidoreductase subunit I OS=Nocardioides sp. (strain BAA-499 / JS614) GN=nuoI PE=3 SV=1 647 770 6.0E-23
sp|A1W1H0|NUOI_CAMJJ NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoI PE=3 SV=1 620 787 7.0E-23
sp|Q0P857|NUOI_CAMJE NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoI PE=3 SV=1 620 787 7.0E-23
sp|C0ZYJ2|NUOI_RHOE4 NADH-quinone oxidoreductase subunit I OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=nuoI PE=3 SV=1 647 770 8.0E-23
sp|Q492I3|NUOI_BLOPB NADH-quinone oxidoreductase subunit I OS=Blochmannia pennsylvanicus (strain BPEN) GN=nuoI PE=3 SV=1 634 772 8.0E-23
sp|A7H5S3|NUOI_CAMJD NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoI PE=3 SV=1 620 787 9.0E-23
sp|Q5HSM0|NUOI_CAMJR NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni (strain RM1221) GN=nuoI PE=3 SV=1 620 787 1.0E-22
sp|Q2K3T7|NUOI2_RHIEC NADH-quinone oxidoreductase subunit I 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoI2 PE=3 SV=1 633 774 1.0E-22
sp|Q9XAR2|NUOI1_STRCO NADH-quinone oxidoreductase subunit I 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoI1 PE=3 SV=1 647 770 3.0E-22
sp|Q20Z46|NUOI2_RHOPB NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoI2 PE=3 SV=1 661 773 5.0E-22
sp|Q1LT96|NUOI_BAUCH NADH-quinone oxidoreductase subunit I OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nuoI PE=3 SV=1 646 778 5.0E-22
sp|Q6MIR9|NUOI_BDEBA NADH-quinone oxidoreductase subunit I OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoI PE=3 SV=1 637 749 5.0E-22
sp|Q07QW8|NUOI1_RHOP5 NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoI1 PE=3 SV=1 647 773 6.0E-22
sp|Q6A6G6|NUOI_PROAC NADH-quinone oxidoreductase subunit I OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nuoI PE=3 SV=1 647 770 1.0E-21
sp|A4FPT3|NUOI_SACEN NADH-quinone oxidoreductase subunit I OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoI PE=3 SV=1 646 770 1.0E-21
sp|B3QSE2|NUOI_CHLT3 NADH-quinone oxidoreductase subunit I OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoI PE=3 SV=1 641 769 2.0E-21
sp|Q7VRV9|NUOI_BLOFL NADH-quinone oxidoreductase subunit I OS=Blochmannia floridanus GN=nuoI PE=3 SV=1 634 772 1.0E-20
sp|Q89AT9|NUOI_BUCBP NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoI PE=3 SV=1 635 772 5.0E-20
sp|Q3AC82|NUOI_CARHZ NADH-quinone oxidoreductase subunit I OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoI PE=3 SV=1 642 770 5.0E-19
sp|Q67KP1|NUOI2_SYMTH NADH-quinone oxidoreductase subunit I 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoI2 PE=3 SV=1 653 789 9.0E-19
sp|A0LEQ3|NUOI1_SYNFM NADH-quinone oxidoreductase subunit I 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoI1 PE=3 SV=1 644 758 3.0E-18
sp|Q4QSC5|NQO9_RHOMR NADH-quinone oxidoreductase subunit 9 OS=Rhodothermus marinus GN=nqo9 PE=3 SV=1 641 788 3.0E-18
sp|Q2IL01|NUOI1_ANADE NADH-quinone oxidoreductase subunit I 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoI1 PE=3 SV=1 661 769 2.0E-17
sp|P30826|NDUS8_TRYBB NADH-ubiquinone oxidoreductase subunit 8 OS=Trypanosoma brucei brucei GN=M-ISP1 PE=2 SV=1 661 748 3.0E-17
sp|O67386|NUOI2_AQUAE NADH-quinone oxidoreductase subunit I 2 OS=Aquifex aeolicus (strain VF5) GN=nuoI2 PE=3 SV=1 630 776 6.0E-17
sp|A4QJQ4|NDHI_AETGR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aethionema grandiflorum GN=ndhI PE=3 SV=1 644 765 1.0E-16
sp|Q8HVU7|NDHI_CHASO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chamaechaenactis scaposa GN=ndhI PE=3 SV=1 644 765 2.0E-16
sp|Q1D8T0|NUOI_MYXXD NADH-quinone oxidoreductase subunit I OS=Myxococcus xanthus (strain DK 1622) GN=nuoI PE=3 SV=1 661 777 2.0E-16
sp|Q01UN8|NUOI2_SOLUE NADH-quinone oxidoreductase subunit I 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoI2 PE=3 SV=1 632 768 2.0E-16
sp|O67337|NUOI1_AQUAE NADH-quinone oxidoreductase subunit I OS=Aquifex aeolicus (strain VF5) GN=nuoI PE=3 SV=1 640 768 2.0E-16
sp|A7H9V8|NUOI_ANADF NADH-quinone oxidoreductase subunit I OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoI PE=3 SV=1 661 745 2.0E-16
sp|A4QK74|NDHI_ARAHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabis hirsuta GN=ndhI PE=3 SV=1 644 765 3.0E-16
sp|Q8HVN1|NDHI_PEROV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perymeniopsis ovalifolia GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|Q8HVR5|NDHI_HULAL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hulsea algida GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|A1E9X8|NDHI_SORBI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sorghum bicolor GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|Q6ENP3|NDHI_SACOF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Saccharum officinarum GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|Q6L3D6|NDHI_SACHY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Saccharum hybrid GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|Q8HVU4|NDHI_CORPT NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Coreopsis petrophiloides GN=ndhI PE=3 SV=1 644 765 4.0E-16
sp|Q8HVT8|NDHI_DIMHO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dimeresia howellii GN=ndhI PE=3 SV=1 644 765 5.0E-16
sp|A4QJH0|NDHI_AETCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aethionema cordifolium GN=ndhI PE=3 SV=1 644 765 5.0E-16
sp|A4QLQ1|NDHI_LOBMA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lobularia maritima GN=ndhI PE=3 SV=1 644 765 5.0E-16
sp|A4QLY9|NDHI_NASOF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nasturtium officinale GN=ndhI PE=3 SV=1 644 765 6.0E-16
sp|A4QLG3|NDHI_LEPVR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lepidium virginicum GN=ndhI PE=3 SV=1 644 765 6.0E-16
sp|A4QL75|NDHI_DRANE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Draba nemorosa GN=ndhI PE=3 SV=1 644 765 6.0E-16
sp|A4QKG1|NDHI_BARVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Barbarea verna GN=ndhI PE=3 SV=1 644 765 6.0E-16
sp|A4QJY6|NDHI_OLIPU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Olimarabidopsis pumila GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|A4QKY8|NDHI_CRUWA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Crucihimalaya wallichii GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|A4QKP9|NDHI_CAPBU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Capsella bursa-pastoris GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|P56755|NDHI_ARATH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVL8|NDHI_RENSL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rensonia salvadorica GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVT0|NDHI_ENYSE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Enydra sessilis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q7I7Y4|NDHI_ZEXSE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zexmenia serrata GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVJ0|NDHI_WEDTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Wedelia tegetis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVJ7|NDHI_VENCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Venegasia carpesioides GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ2|NDHI_TRIPN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trilisa paniculata GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVJ3|NDHI_TILBA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tilesia baccata GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVK6|NDHI_SYNNO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Synedrella nodiflora GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVK2|NDHI_SPHTR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sphagneticola trilobata GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVL9|NDHI_RIEOB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Riencourtia oblongifolia GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVM3|NDHI_PSEAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pseudoclappia arenaria GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVM7|NDHI_PHIZI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Philactis zinnioides GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVL1|NDHI_PERMO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perymenium macrocephalum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVN2|NDHI_PERLI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perityle lindheimeri GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVN7|NDHI_OXYSB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oxypappus scaber GN=ndhI PE=3 SV=2 644 765 7.0E-16
sp|Q8HVN8|NDHI_OTESC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oteiza scandens GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ3|NDHI_MONCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monolopia congdonii GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVN6|NDHI_MELNV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Melanthera nivea GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVP5|NDHI_LUNJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lundellianthus jaliscensis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ0|NDHI_LOXSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Loxothysanus sinuatus GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVP9|NDHI_LIPIN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lipochaeta integrifolia GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ4|NDHI_LAYHE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Layia heterotricha GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ5|NDHI_LASMA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lasianthaea macrocephala GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ8|NDHI_JAUCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jaumea carnosa GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ9|NDHI_JAEHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jaegeria hirta GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVR4|NDHI_HYMFF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hymenopappus filifolius var. filifolius GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVR9|NDHI_GUATU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Guardiola tulocarpus GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVS9|NDHI_ERIST NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eriophyllum staechadifolium GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVS7|NDHI_ERICN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eriophyllum congdonii GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVT1|NDHI_ENGPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Engelmannia peristenia GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVQ1|NDHI_ECLPR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eclipta prostrata GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVT7|NDHI_DIMVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dimerostemma vestitum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVU0|NDHI_DELBI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Delilia biflora GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVU1|NDHI_DAMCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Damnxanthodium calvum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVS6|NDHI_COETI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Coespeletia timotensis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVU5|NDHI_CLIAL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Clibadium alatum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVV0|NDHI_CALVA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Calyptocarpus vialis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVV4|NDHI_BAHAB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bahia absinthifolia GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVV8|NDHI_AMBTR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ambrosia trifida GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q8HVW2|NDHI_ACMRA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Acmella radicans GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q2VEC7|NDHI_SOLTU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum tuberosum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q2MI46|NDHI_SOLLC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum lycopersicum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q2MID3|NDHI_SOLBU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum bulbocastanum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q33BW8|NDHI_NICTO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana tomentosiformis GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q2QD37|NDHI_CUCSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Cucumis sativus GN=ndhI PE=3 SV=1 644 768 7.0E-16
sp|Q8HVK8|NDHI_STESO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Steiractinia sodiroi GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q06R76|NDHI_JASNU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jasminum nudiflorum GN=ndhI PE=3 SV=1 644 765 7.0E-16
sp|Q332S3|NDHI_LACSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lactuca sativa GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVI9|NDHI_ZINJU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zinnia juniperifolia GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ1|NDHI_ZALME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zaluzania megacephala GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ4|NDHI_VILAC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Villanova achilleoides GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ6|NDHI_VERJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Verbesina jacksonii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ8|NDHI_VARMX NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Varilla mexicana GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVT4|NDHI_THYTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Thymophylla tenuiloba GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVK3|NDHI_TETRE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tetragonotheca repanda GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVK4|NDHI_TETOR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tetrachyron orizabensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVK5|NDHI_TARER NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tagetes erecta GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVK9|NDHI_SQUKU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Squamopappus skutchii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL0|NDHI_SPIUR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Spilanthes urens GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL2|NDHI_SMAMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Smallanthus microcephalus GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL5|NDHI_RUMPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rumfordia penninervis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL6|NDHI_RUDHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rudbeckia hirta GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL7|NDHI_ROJSU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rojasianthe superba GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM0|NDHI_RATCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ratibida columnifera GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM6|NDHI_PODEM NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Podachaenium eminens GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM9|NDHI_PEUSC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Peucephyllum schottii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVN3|NDHI_PERCD NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pericome caudata GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP0|NDHI_NEULO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Neurolaena lobata GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP1|NDHI_MONRV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Montanoa revealii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP3|NDHI_MONPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monactis pallatangensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP2|NDHI_MONGR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monolopia gracilens GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP8|NDHI_MADSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Madia sativa GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVQ6|NDHI_LAGRA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lagophylla ramosissima GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVQ7|NDHI_KINPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Kingianthus paradoxus GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR1|NDHI_IDIQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Idiopappus quitensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR2|NDHI_ICHTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ichthyothere terminalis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR7|NDHI_HELAN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Helianthus annuus GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS0|NDHI_GRERE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Greenmaniella resinosa GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS1|NDHI_GALQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Galinsoga quadriradiata GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS2|NDHI_GALPT NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Galeana pratensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS3|NDHI_FLOPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Florestina pedata GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS4|NDHI_FLARA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Flaveria ramosissima GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS5|NDHI_EUTPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eutetras palmeri GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVT5|NDHI_DYSMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dyscritothamnus mirandae GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVT6|NDHI_DUGME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dugesia mexicana GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVT9|NDHI_DESFU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Desmanthodium fruticosum GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVU2|NDHI_DAHCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dahlia coccinea GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVU3|NDHI_CYMVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Cymophora venezuelensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVS8|NDHI_CONNE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Constancea nevinii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVU6|NDHI_CHRHE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chromolepis heterophylla GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV3|NDHI_BEBJU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bebbia juncea GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV6|NDHI_ARNMO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arnica mollis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ2|NDHI_ARNDE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arnica dealbata GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|P06252|NDHI_TOBAC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana tabacum GN=ndhI PE=1 SV=1 644 765 8.0E-16
sp|Q3C1Q0|NDHI_NICSY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana sylvestris GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q7FNR7|NDHI_ATRBE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Atropa belladonna GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVK7|NDHI_STERE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Stevia rebaudiana GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVN5|NDHI_PALAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Palafoxia arida GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV1|NDHI_CALME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Calea megacephala GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM4|NDHI_PSAAN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Psathyrotes annua GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM8|NDHI_PHABO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Phaneroglossa bolusii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR0|NDHI_INUBR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Inula britannica GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV2|NDHI_BLEZA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Blepharispermum zanguebaricum GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV5|NDHI_ATHGP NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Athroisma gracile subsp. psyllioides GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVV7|NDHI_APHJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aphanactis jamesoniana GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q2L959|NDHI_GOSHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium hirsutum GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|A0ZZ89|NDHI_GOSBA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium barbadense GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ9|NDHI_TRIME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trigonospermum melampodioides GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL3|NDHI_SILPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Silphium perfoliatum GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVL4|NDHI_SIGBL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sigesbeckia blakei GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM5|NDHI_POLCN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Polymnia canadensis GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP4|NDHI_MILQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Milleria quinqueflora GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVN9|NDHI_OBLMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oblivia mikanioides GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVJ5|NDHI_BAHTO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bahiopsis tomentosa GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVM2|NDHI_PSIGN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Psilostrophe gnaphalodes GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVP7|NDHI_MARCE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Marshallia caespitosa GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR3|NDHI_HYMLE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hymenoxys lemmonii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q8HVR8|NDHI_HELBG NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Helenium bigelovii GN=ndhI PE=3 SV=1 644 765 8.0E-16
sp|Q09MC2|NDHI_CITSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Citrus sinensis GN=ndhI PE=3 SV=1 635 765 9.0E-16
sp|Q8HVN4|NDHI_PARHY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Parthenium hysterophorus GN=ndhI PE=3 SV=1 644 765 9.0E-16
sp|Q8HVT2|NDHI_ENCCL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Encelia californica GN=ndhI PE=3 SV=1 644 765 9.0E-16
sp|Q06FQ0|NDHI_PELHO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pelargonium hortorum GN=ndhI PE=3 SV=1 644 768 9.0E-16
sp|Q68RV2|NDHI_PANGI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Panax ginseng GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q8HVR6|NDHI_HOFFA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hofmeisteria fasciculata GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q8HVU8|NDHI_CHAPD NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chaetymenia peduncularis GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q8HVM1|NDHI_RAIAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Raillardella argentea GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q9MTH8|NDHI_OENEH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oenothera elata subsp. hookeri GN=ndhI PE=3 SV=2 644 765 1.0E-15
sp|Q0G9Q8|NDHI_DAUCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Daucus carota GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q8HVU9|NDHI_CHAST NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chaenactis santolinoides GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q8HVW3|NDHI_ACAAU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Acanthospermum australe GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|A4GGF0|NDHI_PHAVU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Phaseolus vulgaris GN=ndhI PE=3 SV=1 644 764 1.0E-15
sp|Q49KU4|NDHI_EUCGG NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=ndhI PE=3 SV=1 644 765 1.0E-15
sp|Q00236|NDHI_LEPBY NAD(P)H-quinone oxidoreductase subunit I OS=Leptolyngbya boryana GN=ndhI PE=3 SV=1 636 768 2.0E-15
sp|Q32S03|NDHI_STAPU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Staurastrum punctulatum GN=ndhI PE=3 SV=1 644 768 2.0E-15
sp|Q3M9K8|NDHI_ANAVT NAD(P)H-quinone oxidoreductase subunit I OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ndhI PE=3 SV=1 644 768 2.0E-15
sp|Q9WWM6|NDHI_NOSS1 NAD(P)H-quinone oxidoreductase subunit I OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ndhI PE=3 SV=1 644 768 2.0E-15
sp|Q8HVT3|NDHI_EATNI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eatonella nivea GN=ndhI PE=3 SV=1 644 765 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0043169 cation binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0032774 RNA biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5657
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3411
Ophiocordyceps australis map64 (Brazil) OphauB2|2874
Ophiocordyceps camponoti-floridani Ophcf2|02621
Ophiocordyceps camponoti-rufipedis Ophun1|2477 (this protein)
Ophiocordyceps kimflemingae Ophio5|1365
Ophiocordyceps subramaniannii Hirsu2|8079

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2477
MEAPSSAGDIDESSSIEAEAEVEAETETVVQEPDLHVDTFSGASSSLDGSFDQTLFSMPDSSPGSYLAAMTTTPM
ELALDTEQLGSFSFPNESSRNSLASFSSNIISILQTHESEAPSQGSATLSSCKTMAKAIRWHEDVSAQMPSTATE
LLPSRDVSDRLVGAYFRTYQTIFGILHVPTFHRDYQTFWDTPAVSTPAFTMSLLLVMSIGFVFCPLESAVSRAVV
LKWLSVASAGLASLESNSGRSLDGLRIRCLLLLAQRVSSAKGSARWVSTGSLVRMAMCLGLHRDPANEAGENVSS
FEAESRRKLWAAILELEVQFSMDCGGIPCVDSLDYDTALPANADDFSWPLEGTVVESKPKEEFTSSSFHILLMET
LPVRLKIARIVNSPRCETSFTELLGLSRDLGQHVRLYSAQVKAYTFTSSATPTTFQTKTFELLRIEVESTSLAGS
ESHRVSSEMNRLIVEYLQSVSKRMDSGDFKTKAYILVSASLAYVEASASGVERENYISQAIKKSLDSYYVGLTAR
LPSQSISDLPQETVPPAGQVLMPCWNQSSSMFSWEEGNLALQTLPAMLIRRKLLSARAITSLSTASRTALVAQSH
QRRGYATPKGSLPSNFRTDMANRRRGEDDSTLDRLGKYFLMTEMARGMYLLLEQFFRPPYTIYYPFEKGPISPRF
RGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQESCPVDAIVESPN
AEYATETREELLYNKEKLLSNGDKWEPELAACIRADSPYR*
Coding >Ophun1|2477
ATGGAAGCCCCTTCGTCTGCGGGCGATATCGACGAGTCCAGTTCCATCGAGGCCGAGGCAGAGGTTGAGGCTGAG
ACCGAGACTGTCGTCCAAGAGCCTGACTTACATGTAGACACCTTTAGTGGTGCCAGCAGCAGCCTCGACGGTTCT
TTCGATCAGACGCTATTCTCCATGCCCGATTCGTCTCCTGGCTCCTATCTCGCAGCAATGACCACGACGCCCATG
GAGCTGGCTTTGGATACGGAACAGCTTGGGTCTTTTTCTTTTCCGAACGAGAGCTCCAGAAATTCCCTGGCTTCA
TTCTCATCCAACATCATCTCCATCTTACAGACGCACGAGTCGGAAGCCCCCAGCCAAGGCAGCGCAACACTCTCA
AGCTGCAAAACCATGGCAAAAGCTATCCGCTGGCACGAAGACGTCTCCGCCCAGATGCCTAGCACTGCTACCGAG
CTGCTGCCCTCGCGAGACGTATCAGATCGACTGGTCGGGGCCTATTTCCGCACTTACCAGACCATCTTCGGCATA
CTTCACGTCCCCACGTTTCACAGAGACTATCAGACCTTTTGGGACACGCCAGCCGTCTCAACTCCGGCCTTTACC
ATGTCGTTGCTCCTCGTCATGAGCATCGGCTTCGTCTTTTGCCCGCTCGAAAGTGCCGTCTCCCGGGCTGTGGTC
CTGAAGTGGCTGTCAGTTGCGTCTGCAGGCTTAGCCTCGCTCGAAAGCAACTCGGGACGCAGCCTCGACGGCCTA
CGGATCCGATGCCTCCTTTTGCTCGCCCAACGCGTCTCATCAGCCAAGGGAAGTGCTCGCTGGGTGTCGACTGGA
TCGCTCGTCCGCATGGCCATGTGCCTAGGCCTTCACCGGGATCCCGCGAACGAAGCTGGCGAGAATGTGTCCTCG
TTTGAAGCTGAGTCGCGGCGGAAGCTCTGGGCCGCGATCCTCGAGTTGGAGGTGCAGTTCAGCATGGACTGTGGC
GGTATCCCCTGCGTCGACAGTCTTGATTATGACACGGCCCTGCCAGCCAACGCCGACGACTTCAGCTGGCCGCTA
GAAGGGACCGTTGTCGAGTCGAAGCCCAAGGAAGAGTTCACATCGTCTTCATTTCACATCCTTCTCATGGAGACG
CTGCCGGTGCGGTTAAAGATTGCAAGGATTGTCAACAGTCCTCGATGTGAAACTTCCTTTACAGAACTGCTGGGC
TTAAGCCGAGACCTCGGTCAGCATGTCCGGCTATACTCGGCCCAAGTCAAAGCGTACACCTTCACCAGCAGCGCC
ACTCCCACGACATTTCAGACAAAGACCTTTGAACTTCTTCGGATAGAGGTTGAATCGACGTCCTTGGCAGGGTCA
GAGTCGCATCGCGTGAGCTCGGAAATGAACAGATTGATAGTCGAGTATCTGCAATCCGTATCAAAGCGCATGGAT
TCAGGAGACTTCAAGACCAAGGCTTATATCCTTGTTTCGGCATCGCTGGCTTATGTCGAGGCCTCGGCATCTGGT
GTCGAGCGTGAGAACTACATCTCTCAGGCTATCAAGAAGAGCTTGGATAGCTACTACGTTGGACTGACGGCGAGA
TTACCATCCCAGAGTATAAGCGACTTACCTCAGGAAACAGTTCCGCCTGCCGGTCAGGTCTTGATGCCATGCTGG
AACCAGTCTAGCTCCATGTTTTCTTGGGAGGAAGGGAATTTGGCTTTGCAAACCTTACCGGCGATGCTTATCCGG
CGAAAGCTCCTCTCGGCCCGTGCCATCACTTCCCTCTCTACCGCCAGTCGAACCGCCCTCGTCGCTCAGAGCCAC
CAACGGCGAGGATATGCGACTCCGAAGGGATCATTGCCGAGCAACTTCCGGACGGACATGGCAAACAGGAGGCGG
GGAGAGGACGACAGCACTTTGGACCGCCTGGGCAAGTACTTTTTGATGACGGAAATGGCCAGGGGGATGTATCTG
CTTCTGGAGCAGTTCTTCCGACCTCCCTACACCATCTACTACCCCTTTGAAAAGGGCCCCATATCACCTCGATTC
CGCGGTGAGCACGCGCTGCGCCGATATCCATCTGGCGAGGAACGCTGCATCGCCTGCAAGCTGTGCGAAGCCATC
TGCCCCGCGCAGGCCATCACCATCGAGGCCGAGGAGCGCGCCGATGGCTCCCGCCGAACTACGCGGTACGACATC
GACATGACCAAGTGCATCTACTGCGGCTTCTGTCAGGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAAC
GCGGAGTACGCGACGGAGACGAGGGAGGAACTGCTATACAACAAAGAGAAACTGTTGTCCAACGGAGACAAGTGG
GAGCCAGAGCTGGCAGCTTGCATTCGTGCCGATTCGCCATACCGTTGA
Transcript >Ophun1|2477
ATGGAAGCCCCTTCGTCTGCGGGCGATATCGACGAGTCCAGTTCCATCGAGGCCGAGGCAGAGGTTGAGGCTGAG
ACCGAGACTGTCGTCCAAGAGCCTGACTTACATGTAGACACCTTTAGTGGTGCCAGCAGCAGCCTCGACGGTTCT
TTCGATCAGACGCTATTCTCCATGCCCGATTCGTCTCCTGGCTCCTATCTCGCAGCAATGACCACGACGCCCATG
GAGCTGGCTTTGGATACGGAACAGCTTGGGTCTTTTTCTTTTCCGAACGAGAGCTCCAGAAATTCCCTGGCTTCA
TTCTCATCCAACATCATCTCCATCTTACAGACGCACGAGTCGGAAGCCCCCAGCCAAGGCAGCGCAACACTCTCA
AGCTGCAAAACCATGGCAAAAGCTATCCGCTGGCACGAAGACGTCTCCGCCCAGATGCCTAGCACTGCTACCGAG
CTGCTGCCCTCGCGAGACGTATCAGATCGACTGGTCGGGGCCTATTTCCGCACTTACCAGACCATCTTCGGCATA
CTTCACGTCCCCACGTTTCACAGAGACTATCAGACCTTTTGGGACACGCCAGCCGTCTCAACTCCGGCCTTTACC
ATGTCGTTGCTCCTCGTCATGAGCATCGGCTTCGTCTTTTGCCCGCTCGAAAGTGCCGTCTCCCGGGCTGTGGTC
CTGAAGTGGCTGTCAGTTGCGTCTGCAGGCTTAGCCTCGCTCGAAAGCAACTCGGGACGCAGCCTCGACGGCCTA
CGGATCCGATGCCTCCTTTTGCTCGCCCAACGCGTCTCATCAGCCAAGGGAAGTGCTCGCTGGGTGTCGACTGGA
TCGCTCGTCCGCATGGCCATGTGCCTAGGCCTTCACCGGGATCCCGCGAACGAAGCTGGCGAGAATGTGTCCTCG
TTTGAAGCTGAGTCGCGGCGGAAGCTCTGGGCCGCGATCCTCGAGTTGGAGGTGCAGTTCAGCATGGACTGTGGC
GGTATCCCCTGCGTCGACAGTCTTGATTATGACACGGCCCTGCCAGCCAACGCCGACGACTTCAGCTGGCCGCTA
GAAGGGACCGTTGTCGAGTCGAAGCCCAAGGAAGAGTTCACATCGTCTTCATTTCACATCCTTCTCATGGAGACG
CTGCCGGTGCGGTTAAAGATTGCAAGGATTGTCAACAGTCCTCGATGTGAAACTTCCTTTACAGAACTGCTGGGC
TTAAGCCGAGACCTCGGTCAGCATGTCCGGCTATACTCGGCCCAAGTCAAAGCGTACACCTTCACCAGCAGCGCC
ACTCCCACGACATTTCAGACAAAGACCTTTGAACTTCTTCGGATAGAGGTTGAATCGACGTCCTTGGCAGGGTCA
GAGTCGCATCGCGTGAGCTCGGAAATGAACAGATTGATAGTCGAGTATCTGCAATCCGTATCAAAGCGCATGGAT
TCAGGAGACTTCAAGACCAAGGCTTATATCCTTGTTTCGGCATCGCTGGCTTATGTCGAGGCCTCGGCATCTGGT
GTCGAGCGTGAGAACTACATCTCTCAGGCTATCAAGAAGAGCTTGGATAGCTACTACGTTGGACTGACGGCGAGA
TTACCATCCCAGAGTATAAGCGACTTACCTCAGGAAACAGTTCCGCCTGCCGGTCAGGTCTTGATGCCATGCTGG
AACCAGTCTAGCTCCATGTTTTCTTGGGAGGAAGGGAATTTGGCTTTGCAAACCTTACCGGCGATGCTTATCCGG
CGAAAGCTCCTCTCGGCCCGTGCCATCACTTCCCTCTCTACCGCCAGTCGAACCGCCCTCGTCGCTCAGAGCCAC
CAACGGCGAGGATATGCGACTCCGAAGGGATCATTGCCGAGCAACTTCCGGACGGACATGGCAAACAGGAGGCGG
GGAGAGGACGACAGCACTTTGGACCGCCTGGGCAAGTACTTTTTGATGACGGAAATGGCCAGGGGGATGTATCTG
CTTCTGGAGCAGTTCTTCCGACCTCCCTACACCATCTACTACCCCTTTGAAAAGGGCCCCATATCACCTCGATTC
CGCGGTGAGCACGCGCTGCGCCGATATCCATCTGGCGAGGAACGCTGCATCGCCTGCAAGCTGTGCGAAGCCATC
TGCCCCGCGCAGGCCATCACCATCGAGGCCGAGGAGCGCGCCGATGGCTCCCGCCGAACTACGCGGTACGACATC
GACATGACCAAGTGCATCTACTGCGGCTTCTGTCAGGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAAC
GCGGAGTACGCGACGGAGACGAGGGAGGAACTGCTATACAACAAAGAGAAACTGTTGTCCAACGGAGACAAGTGG
GAGCCAGAGCTGGCAGCTTGCATTCGTGCCGATTCGCCATACCGTTGA
Gene >Ophun1|2477
ATGGAAGCCCCTTCGTCTGCGGGCGATATCGACGAGTCCAGTTCCATCGAGGCCGAGGCAGAGGTTGAGGCTGAG
ACCGAGACTGTCGTCCAAGAGCCTGACTTACATGTAGACACCTTTAGTGGTGCCAGCAGCAGCCTCGACGGTTCT
TTCGATCAGACGCTATTCTCCATGCCCGATTCGTCTCCTGGCTCCTATCTCGCAGCAATGACCACGACGCCCATG
GAGCTGGCTTTGGATACGGAACAGCTTGGGTCTTTTTCTTTTCCGAACGAGAGCTCCAGAAATTCCCTGGCTTCA
TTCTCATCCAGTCCGTTACACGCGCCAACGCCTCACATATTAAAGCCAAAGACGTACGGTAACAGTCATTGGATC
AACTATTTTCACCAGGTGAGTTGCAATACAACCTCTTGCTCGCCCCTTTCCGCAACTCTTACACGCCTCAGGTCC
CAGACATCATCTCCATCTTACAGACGCACGAGTCGGAAGCCCCCAGCCAAGGCAGCGCAACACTCTCAAGCTGCA
AAACCATGGCAAAAGCTATCCGCTGGCACGAAGACGTCTCCGCCCAGATGCCTAGCACTGCTACCGAGCTGCTGC
CCTCGCGAGACGTATCAGATCGACTGGTCGGGGCCTATTTCCGCACTTACCAGACCATCTTCGGCATACTTCACG
TCCCCACGTTTCACAGAGACTATCAGACCTTTTGGGACACGCCAGCCGTCTCAACTCCGGCCTTTACCATGTCGT
TGCTCCTCGTCATGAGCATCGGCTTCGTCTTTTGCCCGCTCGAAAGTGCCGTCTCCCGGGCTGTGGTCCTGAAGT
GGCTGTCAGTTGCGTCTGCAGGCTTAGCCTCGCTCGAAAGCAACTCGGGACGCAGCCTCGACGGCCTACGGATCC
GATGCCTCCTTTTGCTCGCCCAACGCGTCTCATCAGCCAAGGGAAGTGCTCGCTGGGTGTCGACTGGATCGCTCG
TCCGCATGGCCATGTGCCTAGGCCTTCACCGGGATCCCGCGAACGAAGCTGGCGAGAATGTGTCCTCGTTTGAAG
CTGAGTCGCGGCGGAAGCTCTGGGCCGCGATCCTCGAGTTGGAGGTGCAGTTCAGCATGGACTGTGGCGGTATCC
CCTGCGTCGACAGTCTTGATTATGACACGGCCCTGCCAGCCAACGCCGACGACTTCAGCTGGCCGCTAGAAGGGA
CCGTTGTCGAGTCGAAGCCCAAGGAAGAGTTCACATCGTCTTCATTTCACATCCTTCTCATGGAGACGCTGCCGG
TGCGGTTAAAGATTGCAAGGATTGTCAACAGTCCTCGATGTGAAACTTCCTTTACAGAACTGCTGGGCTTAAGCC
GAGACCTCGGTCAGCATGTCCGGCTATACTCGGCCCAAGTCAAAGCGTACACCTTCACCAGCAGCGCCACTCCCA
CGACATTTCAGACAAAGACCTTTGAACTTCTTGTGAGAAGATTCCTCGTCGCCCTTGATCGTCCATTCAACGCAA
TGGGTGAGACTTGTCCGCATTCTCTTTGTTCATCGGGCCTGTGCCTCGAATCGTCTCTCGCGATCCTTTCCTCGC
TCGGTTCCGACGACGACGACTTTCGAATGGCTCAAACACGAGGCAGCGGATTGTTTCACCGGGTTTACATCCAGA
GTGCGCTTCACCTCTGTGGGGAGCTGCGAAAGCGGATAGAGGTTGAATCGACGTCCTTGGCAGGGTCAGAGTCGC
ATCGCGTGAGCTCGGAAATGAACAGATTGATAGTCGAGTATCTGCAATCCGTATCAAAGCGCATGGATTCAGGAG
ACTTCAAGACCAAGGCTTATATCCTTGTTTCGGCATCGCTGGCTTATGTCGAGGCCTCGGCATCTGGTGTCGAGC
GTGAGAACTACATCTCTCAGGCTATCAAGAAGAGCTTGGATAGCTACTACGTTGGACTGACGGCGAGATTACCAT
CCCAGAGTATAAGCGACTTACCTCAGGAAACAGTTCCGCCTGCCGGTCAGGTCTTGATGCCATGCTGGAACCAGT
CTAGCTCCATGTTTTCTTGGGAGGAAGGGAATTTGGTATGTTGATGAGCAACAGAAGCTTACATACATTCGTCGG
CGATGTGCAATAGTCTACGAGATAGTAAGCTTGACAATGAAGTCGTCAAATTACCCTTTCCACATTGAGGCAGTG
AGGTAACATCAAGCGGTCACCAAGTACCATCTTGGCTGGAGTCATCTTCCGGCGAGGGCGACAAGCAATCGGAAT
ATTCCTGCAGTAGGTCCAGCGAGAAACAGAGAATGAAAGCGCATCAACAGATTGCTTCGGGCCTGTCGTGCTGGA
GGACTTGAGGTTCAATCAGCGTGCGATCCACGTGATCATCGGAAGGGAGAGTCACGTGCACTGTAGCCAATCACA
GTCTTACAATTACCTACCCGCCGTCATATCGTCACCTCAACGCAACCACCTCGCAACTCTTCGCCTCTTGCGATT
GCGACCTCAACACACCAGTAACCCTCTCATCCATCAGCTCCCGTTTCGCCTTCTCTGGTTTGCCTCCTCTGGGAA
CCCAATCCGAAATCACCGCTGAGCTTCCACTCAAGCTCCAGTCTTATCCTCCGCCATGGCTCAGGCTTTGCAAAC
CTTACCGGCGATGCTTATCCGGCGAAAGCTCCTCTCGGCCCGTGCCATCACTTCCCTCTCTACCGCCAGTCGAAC
CGCCCTCGTCGCTCAGAGCCACCAACGGCGAGGATATGCGACTCCGAAGGGATCATTGCCGAGCAACTTCCGGAC
GGACATGGCAAACAGGAGGCGGGGAGAGGACGACAGCACTTTGGACCGCCTGGGCAAGTACTTTTTGATGACGGA
AATGGCCAGGGGGATGTATCTGCTTCTGGAGCAGTTCTTCCGACCTCCGTAGGTTTCGTCGCTTTCGTCAGGTCG
CGGATGATTGTTGTTGACTTACTCAATAGCTACACCATCTACTACCCCTTTGAAAAGGTACAAACGCTCCATCGA
TATTATCTTCGCTTTCGAAACATCTGACACGAGTGCAGGGCCCCATATCACCTCGATTCCGCGGTGAGCACGCGC
TGCGCCGATATCCATCTGGCGAGGAACGCTGCATCGCCTGCAAGCTGTGCGAAGCCGTACGTTTCGCTTTCACGA
CCGCTTCGAAACCTCAGCTGATGGGCTTCTTGCCATCTAGATCTGCCCCGCGCAGGCCATCACCATCGAGGCCGA
GGAGCGCGCCGATGGCTCCCGCCGAACTACGCGGTACGACATCGACATGACCAAGTGCATCTACTGCGGCTTCTG
TCAGGAGTCGTGCCCCGTCGACGCCATTGTCGAGAGTCCCAACGCGGAGTACGCGACGGAGACGAGGGAGGAACT
GCTATACAACAAAGGTGCGTCGCCGCGGGTAACCAGTCGTCAACTAGGGAGACTGATGCAGAGGGCAGAGAAACT
GTTGTCCAACGGAGACAAGTGGGAGCCAGAGCTGGCAGCTTGCATTCGTGCCGATTCGCCATACCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail