Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|2465
Gene name
LocationContig_222:14920..16220
Strand-
Gene length (bp)1300
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00491 Arginase Arginase family 4.7E-77 37 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33280|ARGI_NEUCR Arginase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aga-1 PE=1 SV=3 22 345 4.0E-174
sp|P40906|ARGI_COCP7 Arginase OS=Coccidioides posadasii (strain C735) GN=ARG PE=3 SV=2 21 345 3.0E-158
sp|Q1E180|ARGI_COCIM Arginase OS=Coccidioides immitis (strain RS) GN=ARG PE=3 SV=1 21 345 2.0E-157
sp|Q12611|ARGI_EMENI Arginase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agaA PE=3 SV=2 21 345 7.0E-154
sp|Q6CLS8|ARGI_KLULA Arginase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR1 PE=1 SV=1 33 345 2.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33280|ARGI_NEUCR Arginase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aga-1 PE=1 SV=3 22 345 4.0E-174
sp|P40906|ARGI_COCP7 Arginase OS=Coccidioides posadasii (strain C735) GN=ARG PE=3 SV=2 21 345 3.0E-158
sp|Q1E180|ARGI_COCIM Arginase OS=Coccidioides immitis (strain RS) GN=ARG PE=3 SV=1 21 345 2.0E-157
sp|Q12611|ARGI_EMENI Arginase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agaA PE=3 SV=2 21 345 7.0E-154
sp|Q6CLS8|ARGI_KLULA Arginase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR1 PE=1 SV=1 33 345 2.0E-90
sp|Q74ZW4|ARGI_ASHGO Arginase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CAR1 PE=3 SV=1 39 345 2.0E-87
sp|Q61176|ARGI1_MOUSE Arginase-1 OS=Mus musculus GN=Arg1 PE=1 SV=1 33 341 2.0E-82
sp|P37818|ARGI1_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car1 PE=3 SV=1 37 345 3.0E-82
sp|Q95JC8|ARGI1_PIG Arginase-1 OS=Sus scrofa GN=ARG1 PE=2 SV=1 37 341 4.0E-82
sp|P07824|ARGI1_RAT Arginase-1 OS=Rattus norvegicus GN=Arg1 PE=1 SV=2 33 341 1.0E-81
sp|Q10066|ARGI2_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aru1 PE=3 SV=1 37 345 2.0E-81
sp|Q2KJ64|ARGI1_BOVIN Arginase-1 OS=Bos taurus GN=ARG1 PE=2 SV=1 33 341 3.0E-81
sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2 37 341 5.0E-81
sp|P00812|ARGI_YEAST Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR1 PE=1 SV=1 36 345 3.0E-80
sp|Q95KM0|ARGI1_RABIT Arginase-1 OS=Oryctolagus cuniculus GN=ARG1 PE=2 SV=2 37 341 6.0E-80
sp|O08701|ARGI2_RAT Arginase-2, mitochondrial OS=Rattus norvegicus GN=Arg2 PE=2 SV=1 22 343 3.0E-79
sp|O08691|ARGI2_MOUSE Arginase-2, mitochondrial OS=Mus musculus GN=Arg2 PE=1 SV=1 22 343 7.0E-79
sp|P49900|ARGI_LITCT Arginase, hepatic OS=Lithobates catesbeiana PE=2 SV=1 37 342 1.0E-78
sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1 37 343 1.0E-78
sp|Q58DL1|ARGI2_BOVIN Arginase-2, mitochondrial OS=Bos taurus GN=ARG2 PE=2 SV=1 37 343 2.0E-77
sp|Q4VK78|ARGI2_RABIT Arginase-2, mitochondrial OS=Oryctolagus cuniculus GN=ARG2 PE=2 SV=1 37 343 1.0E-73
sp|Q91554|ARGN2_XENLA Arginase, non-hepatic 2 OS=Xenopus laevis GN=arg2-b PE=2 SV=1 37 343 7.0E-72
sp|Q91553|ARGN1_XENLA Arginase, non-hepatic 1 OS=Xenopus laevis GN=arg2-a PE=2 SV=1 37 343 1.0E-71
sp|Q91555|ARGN3_XENLA Arginase, non-hepatic 3 OS=Xenopus laevis GN=arg2-c PE=2 SV=1 37 343 2.0E-70
sp|P30759|ARGI1_XENLA Arginase-1 OS=Xenopus laevis GN=arg1 PE=2 SV=1 37 342 6.0E-63
sp|Q6GER3|ARGI_STAAR Arginase OS=Staphylococcus aureus (strain MRSA252) GN=arg PE=3 SV=1 37 345 6.0E-63
sp|P60088|ARGI_STAAN Arginase OS=Staphylococcus aureus (strain N315) GN=arg PE=1 SV=1 47 345 2.0E-62
sp|P60087|ARGI_STAAM Arginase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arg PE=3 SV=1 47 345 2.0E-62
sp|P60086|ARGI_STAAC Arginase OS=Staphylococcus aureus (strain COL) GN=arg PE=3 SV=1 47 345 2.0E-62
sp|Q8NVE3|ARGI_STAAW Arginase OS=Staphylococcus aureus (strain MW2) GN=arg PE=3 SV=1 47 345 3.0E-62
sp|Q6G7E9|ARGI_STAAS Arginase OS=Staphylococcus aureus (strain MSSA476) GN=arg PE=3 SV=1 47 345 3.0E-62
sp|P53608|ARGI_BACCD Arginase OS=Bacillus caldovelox GN=rocF PE=1 SV=1 37 345 2.0E-60
sp|P39138|ARGI_BACSU Arginase OS=Bacillus subtilis (strain 168) GN=rocF PE=1 SV=1 37 345 2.0E-60
sp|Q7M0Z3|ARGI_BREBE Arginase OS=Brevibacillus brevis GN=rocF PE=1 SV=1 36 345 5.0E-54
sp|P14012|ARGI_AGRFC Arginase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=arcA PE=2 SV=1 47 318 5.0E-38
sp|P0A2Y0|ARGI_BRUSU Arginase OS=Brucella suis biovar 1 (strain 1330) GN=arcB PE=3 SV=1 36 318 4.0E-37
sp|P0A2X9|ARGI_BRUME Arginase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=arcB PE=3 SV=1 36 318 4.0E-37
sp|P0A2Y1|ARGI_BRUAB Arginase OS=Brucella abortus biovar 1 (strain 9-941) GN=arcB PE=3 SV=1 36 318 4.0E-37
sp|Q5SJ85|SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1129 PE=1 SV=1 116 341 4.0E-16
sp|Q72JK8|SPEBH_THET2 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0764 PE=1 SV=1 116 341 2.0E-15
sp|Q9I3S3|GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gbuA PE=1 SV=1 123 321 8.0E-15
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 102 333 3.0E-13
sp|P0DJQ3|PAH_STRCL Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus GN=pah PE=1 SV=1 128 326 5.0E-13
sp|P0DJQ4|PAH_STRC2 Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pah PE=3 SV=1 128 326 5.0E-13
sp|B5RE39|SPEB_SALG2 Agmatinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B5QXK5|SPEB_SALEP Agmatinase OS=Salmonella enteritidis PT4 (strain P125109) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B5FUJ0|SPEB_SALDC Agmatinase OS=Salmonella dublin (strain CT_02021853) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|P60656|SPEB_SALTY Agmatinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|P60655|SPEB_SALTI Agmatinase OS=Salmonella typhi GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B4TV53|SPEB_SALSV Agmatinase OS=Salmonella schwarzengrund (strain CVM19633) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B5BFP3|SPEB_SALPK Agmatinase OS=Salmonella paratyphi A (strain AKU_12601) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|C0PY54|SPEB_SALPC Agmatinase OS=Salmonella paratyphi C (strain RKS4594) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|A9N3R6|SPEB_SALPB Agmatinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|Q5PJH7|SPEB_SALPA Agmatinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B4T5I5|SPEB_SALNS Agmatinase OS=Salmonella newport (strain SL254) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B4THG3|SPEB_SALHS Agmatinase OS=Salmonella heidelberg (strain SL476) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|Q57K36|SPEB_SALCH Agmatinase OS=Salmonella choleraesuis (strain SC-B67) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|B5F5K3|SPEB_SALA4 Agmatinase OS=Salmonella agona (strain SL483) GN=speB PE=3 SV=1 111 322 8.0E-13
sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2 122 316 1.0E-12
sp|B7NI01|SPEB_ECO7I Agmatinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=speB PE=3 SV=1 111 322 1.0E-12
sp|A8APF8|SPEB_CITK8 Agmatinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=speB PE=3 SV=1 111 322 1.0E-12
sp|Q3YXT4|SPEB_SHISS Agmatinase OS=Shigella sonnei (strain Ss046) GN=speB PE=3 SV=1 111 322 2.0E-12
sp|Q9I6K2|GPUA_PSEAE Guanidinopropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpuA PE=1 SV=1 119 318 3.0E-12
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 37 322 4.0E-12
sp|Q32C02|SPEB_SHIDS Agmatinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|P60657|SPEB_SHIFL Agmatinase OS=Shigella flexneri GN=speB PE=3 SV=1 111 322 6.0E-12
sp|Q0T0V7|SPEB_SHIF8 Agmatinase OS=Shigella flexneri serotype 5b (strain 8401) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|Q31WK0|SPEB_SHIBS Agmatinase OS=Shigella boydii serotype 4 (strain Sb227) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B2U0V8|SPEB_SHIB3 Agmatinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B7LPE7|SPEB_ESCF3 Agmatinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B1LDE6|SPEB_ECOSM Agmatinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B7N7I9|SPEB_ECOLU Agmatinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|P60651|SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) GN=speB PE=1 SV=1 111 322 6.0E-12
sp|B1IT67|SPEB_ECOLC Agmatinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B1XF99|SPEB_ECODH Agmatinase OS=Escherichia coli (strain K12 / DH10B) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|C5A0K6|SPEB_ECOBW Agmatinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B7LYW6|SPEB_ECO8A Agmatinase OS=Escherichia coli O8 (strain IAI1) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|B5YQD4|SPEB_ECO5E Agmatinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|P60652|SPEB_ECO57 Agmatinase OS=Escherichia coli O157:H7 GN=speB PE=3 SV=1 111 322 6.0E-12
sp|A7ZR59|SPEB_ECO24 Agmatinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=speB PE=3 SV=1 111 322 6.0E-12
sp|Q90XD2|SPEB_CHICK Agmatinase, mitochondrial OS=Gallus gallus GN=AGMAT PE=2 SV=1 116 316 7.0E-12
sp|Q1R791|SPEB_ECOUT Agmatinase OS=Escherichia coli (strain UTI89 / UPEC) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|Q8FE36|SPEB_ECOL6 Agmatinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|Q0TDR4|SPEB_ECOL5 Agmatinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|A1AFC5|SPEB_ECOK1 Agmatinase OS=Escherichia coli O1:K1 / APEC GN=speB PE=3 SV=1 111 322 9.0E-12
sp|B7MZN5|SPEB_ECO81 Agmatinase OS=Escherichia coli O81 (strain ED1a) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|B7MMC5|SPEB_ECO45 Agmatinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|B7UHY3|SPEB_ECO27 Agmatinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speB PE=3 SV=1 111 322 9.0E-12
sp|Q7P0S6|SPEB_CHRVO Agmatinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=speB PE=3 SV=1 102 336 1.0E-11
sp|A4WE75|SPEB_ENT38 Agmatinase OS=Enterobacter sp. (strain 638) GN=speB PE=3 SV=1 111 322 1.0E-11
sp|Q2NRD3|SPEB_SODGM Agmatinase OS=Sodalis glossinidius (strain morsitans) GN=speB PE=3 SV=1 111 317 1.0E-11
sp|Q7N122|SPEB_PHOLL Agmatinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=speB PE=3 SV=1 111 325 1.0E-11
sp|Q7X3P1|SPEB_PROMI Agmatinase OS=Proteus mirabilis GN=speB PE=3 SV=2 111 317 2.0E-11
sp|B4F1A3|SPEB_PROMH Agmatinase OS=Proteus mirabilis (strain HI4320) GN=speB PE=3 SV=1 111 317 2.0E-11
sp|A7MJQ1|SPEB_CROS8 Agmatinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=speB PE=3 SV=1 111 317 2.0E-11
sp|Q8FQ76|HUTG_COREF Formimidoylglutamase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hutG PE=3 SV=1 110 336 3.0E-11
sp|B6I775|SPEB_ECOSE Agmatinase OS=Escherichia coli (strain SE11) GN=speB PE=3 SV=1 111 322 4.0E-11
sp|B7LFJ6|SPEB_ECO55 Agmatinase OS=Escherichia coli (strain 55989 / EAEC) GN=speB PE=3 SV=1 111 322 4.0E-11
sp|A6TDU9|SPEB_KLEP7 Agmatinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=speB PE=3 SV=1 111 322 5.0E-11
sp|B5XUB2|SPEB_KLEP3 Agmatinase OS=Klebsiella pneumoniae (strain 342) GN=speB PE=3 SV=1 111 322 5.0E-11
sp|C5BAV1|SPEB_EDWI9 Agmatinase OS=Edwardsiella ictaluri (strain 93-146) GN=speB PE=3 SV=1 111 322 6.0E-11
sp|A8A477|SPEB_ECOHS Agmatinase OS=Escherichia coli O9:H4 (strain HS) GN=speB PE=3 SV=1 111 322 7.0E-11
sp|P72703|SPEB1_SYNY3 Agmatinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB1 PE=3 SV=1 50 316 8.0E-11
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 127 316 2.0E-10
sp|A8GIX7|SPEB_SERP5 Agmatinase OS=Serratia proteamaculans (strain 568) GN=speB PE=3 SV=1 111 336 3.0E-10
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 127 322 3.0E-10
sp|Q9KBE3|HUTG_BACHD Formimidoylglutamase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hutG PE=3 SV=1 111 322 3.0E-10
sp|A2AS89|SPEB_MOUSE Agmatinase, mitochondrial OS=Mus musculus GN=Agmat PE=1 SV=1 113 316 6.0E-10
sp|Q0D2L3|SPEB_RAT Agmatinase, mitochondrial OS=Rattus norvegicus GN=Agmat PE=2 SV=1 112 316 6.0E-10
sp|P19268|YHMF_METFE Uncharacterized 32.2 kDa protein in hmfB 3'region OS=Methanothermus fervidus PE=3 SV=1 111 314 8.0E-10
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 127 322 8.0E-10
sp|P60654|SPEB_NEIMB Agmatinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=speB PE=3 SV=1 110 325 2.0E-09
sp|P60653|SPEB_NEIMA Agmatinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=speB PE=3 SV=1 110 325 2.0E-09
sp|Q7X7N2|ARGI1_ORYSJ Arginase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=ARG1 PE=2 SV=1 128 316 2.0E-09
sp|Q7VRG4|SPEB_BLOFL Agmatinase OS=Blochmannia floridanus GN=speB PE=3 SV=1 127 336 2.0E-09
sp|B8AU84|ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica GN=B0616E02-H0507E05.7 PE=1 SV=1 128 316 2.0E-09
sp|B4RP98|SPEB_NEIG2 Agmatinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=speB PE=3 SV=1 110 325 3.0E-09
sp|Q5F6R3|SPEB_NEIG1 Agmatinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=speB PE=3 SV=1 110 325 3.0E-09
sp|A1KVF9|SPEB_NEIMF Agmatinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=speB PE=3 SV=1 122 325 3.0E-09
sp|A9M254|SPEB_NEIM0 Agmatinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=speB PE=3 SV=1 122 325 3.0E-09
sp|P73270|SPEB2_SYNY3 Probable agmatinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB2 PE=3 SV=1 105 333 6.0E-09
sp|Q9K6B9|SPEB_BACHD Agmatinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=speB PE=3 SV=2 107 340 2.0E-08
sp|Q471H6|HUTG_CUPPJ Formimidoylglutamase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hutG PE=3 SV=1 113 316 2.0E-08
sp|P46637|ARGI1_ARATH Arginase 1, mitochondrial OS=Arabidopsis thaliana GN=ARGAH1 PE=2 SV=1 128 316 4.0E-08
sp|Q9ZPF5|ARGI2_ARATH Arginase 2, mitochondrial OS=Arabidopsis thaliana GN=ARGAH2 PE=2 SV=1 128 316 2.0E-07
sp|D2Z025|DCSB_STRLA N(omega)-hydroxy-L-arginine amidinohydrolase OS=Streptomyces lavendulae GN=dcsB PE=1 SV=1 151 315 3.0E-07
sp|O49046|ARGI_SOYBN Arginase OS=Glycine max GN=AG1 PE=2 SV=1 128 316 1.0E-06
sp|P60109|HUTG_CHRVO Formimidoylglutamase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hutG PE=3 SV=1 106 337 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4462
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1544
Ophiocordyceps australis map64 (Brazil) OphauB2|1297
Ophiocordyceps camponoti-floridani Ophcf2|05182
Ophiocordyceps camponoti-rufipedis Ophun1|2465 (this protein)
Ophiocordyceps kimflemingae Ophio5|6236
Ophiocordyceps subramaniannii Hirsu2|9265

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|2465
MGGYRLLLSAVDDLPQPLIGTMSNSVVCRFLDQPDHLGVVAVGFSGGQPKAGVDAGPAALIQSGLLQQIRDELGY
RVHGDGQVSDYRHLVPESDPDYRGMKNPKTVSAVNQELATQVYQHASQGRLVLTLGGDHSIAIGSLAGSAKATRE
RLNSDVAVIWVDAHADINTPESSESGNIHGMPVAFATGLARDDNDEYFGWIKDDMRVSLRKLVYIGLRDVDPGEK
KILRDHGIKAFSMYDVDRHGISRVMEMALAHIGTHTPIHLSFDVDALDPMWAPGTGTPVRGGLTLREGDFICESV
HQTGQLVAIDLVEVNPSLAATEAHAQETVRAGCSLVRCALGETLL*
Coding >Ophun1|2465
ATGGGCGGCTATCGCCTCCTCCTCTCGGCCGTCGACGACTTGCCGCAGCCTCTTATCGGAACCATGTCCAACTCG
GTCGTTTGCCGTTTTCTCGACCAGCCGGATCATCTCGGTGTCGTTGCCGTCGGTTTCTCGGGTGGTCAGCCCAAG
GCCGGTGTCGACGCCGGTCCCGCAGCCCTCATCCAGTCGGGCCTCTTGCAACAGATCCGCGATGAGCTGGGCTAC
CGAGTCCATGGCGACGGCCAGGTCAGCGACTATCGCCACCTGGTCCCCGAGTCCGACCCCGATTACCGTGGCATG
AAGAACCCCAAGACGGTCTCGGCCGTCAACCAGGAGCTCGCCACGCAGGTCTACCAGCACGCGTCACAGGGTCGT
CTGGTCCTGACGCTGGGCGGTGACCACAGCATCGCCATCGGCTCTCTCGCTGGTTCGGCAAAGGCGACGCGCGAG
CGGCTCAATAGCGACGTGGCCGTCATCTGGGTCGATGCTCACGCCGATATCAATACTCCCGAGTCGAGCGAAAGC
GGTAATATCCACGGCATGCCCGTTGCCTTTGCCACTGGCCTCGCCCGCGACGACAACGACGAATACTTTGGTTGG
ATCAAGGACGATATGCGCGTCAGCCTTCGTAAGCTCGTCTACATTGGCCTGCGCGACGTCGATCCGGGCGAGAAG
AAGATTCTGCGTGACCATGGCATCAAGGCCTTTTCCATGTACGATGTCGATCGTCATGGCATCAGCCGCGTCATG
GAAATGGCTCTCGCACATATTGGCACGCACACGCCCATCCACCTGTCCTTTGATGTCGATGCCCTCGACCCTATG
TGGGCTCCGGGCACCGGTACGCCTGTTCGCGGGGGACTGACGTTGCGCGAGGGCGATTTCATCTGCGAGAGCGTT
CATCAGACGGGCCAGCTTGTGGCCATTGACCTCGTCGAGGTTAACCCCAGCTTGGCCGCCACCGAAGCCCACGCC
CAGGAGACGGTCCGGGCCGGCTGCTCGTTGGTTCGCTGTGCACTGGGCGAGACGCTGCTTTAG
Transcript >Ophun1|2465
ATGGGCGGCTATCGCCTCCTCCTCTCGGCCGTCGACGACTTGCCGCAGCCTCTTATCGGAACCATGTCCAACTCG
GTCGTTTGCCGTTTTCTCGACCAGCCGGATCATCTCGGTGTCGTTGCCGTCGGTTTCTCGGGTGGTCAGCCCAAG
GCCGGTGTCGACGCCGGTCCCGCAGCCCTCATCCAGTCGGGCCTCTTGCAACAGATCCGCGATGAGCTGGGCTAC
CGAGTCCATGGCGACGGCCAGGTCAGCGACTATCGCCACCTGGTCCCCGAGTCCGACCCCGATTACCGTGGCATG
AAGAACCCCAAGACGGTCTCGGCCGTCAACCAGGAGCTCGCCACGCAGGTCTACCAGCACGCGTCACAGGGTCGT
CTGGTCCTGACGCTGGGCGGTGACCACAGCATCGCCATCGGCTCTCTCGCTGGTTCGGCAAAGGCGACGCGCGAG
CGGCTCAATAGCGACGTGGCCGTCATCTGGGTCGATGCTCACGCCGATATCAATACTCCCGAGTCGAGCGAAAGC
GGTAATATCCACGGCATGCCCGTTGCCTTTGCCACTGGCCTCGCCCGCGACGACAACGACGAATACTTTGGTTGG
ATCAAGGACGATATGCGCGTCAGCCTTCGTAAGCTCGTCTACATTGGCCTGCGCGACGTCGATCCGGGCGAGAAG
AAGATTCTGCGTGACCATGGCATCAAGGCCTTTTCCATGTACGATGTCGATCGTCATGGCATCAGCCGCGTCATG
GAAATGGCTCTCGCACATATTGGCACGCACACGCCCATCCACCTGTCCTTTGATGTCGATGCCCTCGACCCTATG
TGGGCTCCGGGCACCGGTACGCCTGTTCGCGGGGGACTGACGTTGCGCGAGGGCGATTTCATCTGCGAGAGCGTT
CATCAGACGGGCCAGCTTGTGGCCATTGACCTCGTCGAGGTTAACCCCAGCTTGGCCGCCACCGAAGCCCACGCC
CAGGAGACGGTCCGGGCCGGCTGCTCGTTGGTTCGCTGTGCACTGGGCGAGACGCTGCTTTAG
Gene >Ophun1|2465
ATGGGCGGCTATCGCCTCCTCCTCTCGGCCGTCGACGACTTGCCGCAGCCTCTTATCGGAACCATGTCCAACTCG
GTCGTTTGCCGTTTTCTCGACCAGCCGGATCATCTCGGTGTCGTTGCCGTCGGTTTCTCGGGTGGTCAGGTATGA
CGTGCTTTTTTTTTTTTCTCTCTCGGAGGGGGTTTTCCTTTCTTCTGCTGTTTGTCCCCTGGCAGATCAATCCAC
TGGCCACCACCGGGCCATCATTGTCTCCGCTGCAGCCACTGCGACCTCCCAGTCATGGATGCCCCTGGCCGTGCC
TGACAGCCCCCAAATCCCATCTCCAGCGCAATCAATGACCGTTTCTGCAGCCCAAGGCCGGTGTCGACGCCGGTC
CCGCAGCCCTCATCCAGTCGGGCCTCTTGCAACAGATCCGCGATGAGCTGGGCTACCGAGTCCATGGCGACGGCC
AGGTCAGCGACTATCGCCACCTGGTCCCCGAGTCCGACCCCGATTACCGTGGCATGAAGAACCCCAAGACGGTCT
CGGCCGTCAACCAGGAGCTCGCCACGCAGGTCTACCAGCACGCGTCACAGGGTCGTCTGGTCCTGACGCTGGGCG
GTGACCACAGCATCGCCATCGGCTCTCTCGCTGGTTCGGCAAAGGCGACGCGCGAGCGGCTCAATAGCGACGTGG
CCGTCATCTGGGTCGATGCTCACGCCGATATCAATACTCCCGAGTCGAGCGAAAGCGGTAATATCCACGGCATGC
CCGTTGCCTTTGCCACTGGCCTCGCCCGCGACGACAACGACGAATACTTTGGTTGGATCAAGGACGATATGCGCG
TCAGCCTTCGTAAGCTCGTCTACATTGGCCTGCGCGACGTCGATCCGGGCGAGAAGAAGATTCTGCGTGACCATG
GCATCAAGGCCTTTTCCATGTACGATGTCGATCGGTGAGCCCATCCCTGAAACCCCCTCTATTCAGTCCTAGTCT
TGACTCTCGGCCCAGTCATGGCATCAGCCGCGTCATGGAAATGGCTCTCGCACATATTGGCACGCACACGCCCAT
CCACCTGTCCTTTGATGTCGATGCCCTCGACCCTATGTGGGCTCCGGGCACCGGTACGCCTGTTCGCGGGGGACT
GACGTTGCGCGAGGGCGATTTCATCTGCGAGAGCGTTCATCAGACGGGCCAGCTTGTGGCCATTGACCTCGTCGA
GGTTAACCCCAGCTTGGCCGCCACCGAAGCCCACGCCCAGGAGACGGTCCGGGCCGGCTGCTCGTTGGTTCGCTG
TGCACTGGGCGAGACGCTGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail